SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004840 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004840
Domain Number 1 Region: 187-448
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.17e-85
Family Eukaryotic proteases 0.000000801
Further Details:      
 
Domain Number 2 Region: 61-124
Classification Level Classification E-value
Superfamily GLA-domain 4.12e-22
Family GLA-domain 0.00045
Further Details:      
 
Domain Number 3 Region: 114-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000798
Family EGF-type module 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004840   Gene: ENSSHAG00000004248   Transcript: ENSSHAT00000004888
Sequence length 460
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849598.1:95837:117396:-1 gene:ENSSHAG00000004248 transcript:ENSSHAT00000004888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRRRYSQSSTVHICISSSKMWHLVSFLVFVASWDSLGGHANSVFSSSKKANQILRIQK
RANSFLEEIKPGNLERECHEEICDLEEVQEIFTTREDTLAYWSKYVDGDLCEPHPCNNGT
CIDGIGSFQCICNEGWEGRLCEHEVRYTNCSLNNGGCAHYCTEDLKNQQRYCMCAPGYKE
EDNPMECKPVANFPCGKPKVSYPMPNSEELQIRILGGRPANKGDSPWQVILLDSRAKLKC
GGVLIHSSWVLTAAHCVEHPKYLIVRLGEYNIRRHENSEMDFSIQETIVHPNYTKSTSDN
DIALLYLNKPVAFSKYILPICLPNQGLAHRELMKVGKEMVITGWGRQFEESKNRTYILRF
IKIPLASHTECSQTMQNSVSENMLCAGILGDRRDACEGDSGGPMITEFRGTWFLVGLVSW
GEGCGRPNNFGIYTKVSQYLSWMQDHIKAKELSSKSESAP
Download sequence
Identical sequences G3VNT5
ENSSHAP00000004840 ENSSHAP00000004840 XP_003763815.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]