SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004858 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004858
Domain Number 1 Region: 29-126
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-27
Family Kringle modules 0.001
Further Details:      
 
Domain Number 2 Region: 214-320
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.05e-24
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004858   Gene: ENSSHAG00000004264   Transcript: ENSSHAT00000004907
Sequence length 350
Comment pep:known_by_projection scaffold:DEVIL7.0:GL842416.1:96519:112208:1 gene:ENSSHAG00000004264 transcript:ENSSHAT00000004907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVPHLAELTRLTQKSVAGGVGVGAGPRPQAECFTVNGVDYRGRQNWTALHGGKTCLFWNE
TFQHPYNTLKYPHGEGGLGDHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNL
GCYRDHGNPPPLTGTSKTSNKLTIQNCISFCRGQKFKFAGMESGYACFCGNNPDYWKYGE
TASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAVSSVIYSPDFPDTYATGRVC
YWTIHVAGASRLLFNFTLFDIRDSADMVELLDGYTHRVLARFSGRSRPPPSFNVSLDFVI
LYFFSDRINQAQGFAVLYQALREEPPQAGPTLNQTAAEVITEQTNLSLSA
Download sequence
Identical sequences G3VNV3
ENSSHAP00000004858 ENSSHAP00000004858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]