SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005065 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005065
Domain Number 1 Region: 37-95
Classification Level Classification E-value
Superfamily RING/U-box 1.04e-17
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005065   Gene: ENSSHAG00000004431   Transcript: ENSSHAT00000005115
Sequence length 195
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841881.1:104203:115885:1 gene:ENSSHAG00000004431 transcript:ENSSHAT00000005115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEMASKGPTTSTSPENSSAGGTSGSSNGPGENSSQDSTFECNICLDTAKDAVISLCGHL
FCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEP
ENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRL
FLFVALVIMFWLLIA
Download sequence
Identical sequences G3VPG0
XP_003762857.2.9362 XP_012399412.1.9362 ENSSHAP00000005065 ENSSHAP00000005065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]