SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005179 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005179
Domain Number 1 Region: 869-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000558
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 2 Region: 337-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000725
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 3 Region: 823-871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000026
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 4 Region: 775-816
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000725
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 5 Region: 930-980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000809
Family Laminin-type module 0.06
Further Details:      
 
Domain Number 6 Region: 273-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000111
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 7 Region: 978-1029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 8 Region: 512-553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 9 Region: 460-504
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000162
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1086-1128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 11 Region: 1030-1083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.002
Further Details:      
 
Domain Number 12 Region: 421-462
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 13 Region: 1134-1181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family Laminin-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005179   Gene: ENSSHAG00000004532   Transcript: ENSSHAT00000005231
Sequence length 1788
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861641.1:109128:193058:-1 gene:ENSSHAG00000004532 transcript:ENSSHAT00000005231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLQVHLFGFLVSALWGVYVHAQEPEYSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGL
HKPEPYCIVSHLQEDKKCFICNSQDPYHETFNPDSHLIENVVTTFAPNRLKIWWQSENGV
ENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCESSFPGVS
TGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFV
KLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGHNEEVEGMVHGHC
MCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSGSCHFDMAVYLATGNIS
GGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNICEACTCDPAGSQNGGICDSYTDFS
AGLIAGQCRCKLYTEGEKCDICKEGFYGLSADDPFGCQSCACNPLGTIPGGNPCDSETGY
CYCKRLVTGQHCDQCLQEHWGLSNDLDGCRPCDCDVGGSLNNNCSAESGQCLCRSHMIGR
QCNEVESGYYFTTLDHYIYEAEEAHFGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLE
FFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTVPDDDNQVVSLS
PGSRYVVLPRPVCFEKGVNYTVRLELPQYTSSDAGVESPYTLIDSLVLMPYCKSLDIFTV
GGSGDGVITNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQ
GSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPNGCKPCDCHMQGSINAFCDPVTG
QCHCFQGVYTRQCDRCLPGYWGFPNCQPCQCNGHADDCDPISGECFGCQDYTSGHNCERC
LPGYYGDPIIGSGDHCRPCPCPDGPESGRQFANTCYQDPITLQLVCVCNPGYLGARCDEC
ASGYFGNPGDVGGVCQPCQCHNNIDTTDPESCDKGTGRCLKCLYHTEGENCQLCKFGYYG
DALRQDCRKCVCNYLGTVQEHCDGSDCQCDKITGQCLCLPNVIGQNCDHCAPNTWNLASG
MGCEPCSCDAAHSFGPSCNEFTGQCQCMPGFGGRTCNECQELFWGDPNVECQACDCDPRG
IETRQCDQSTGQCVCIEGVEGTRCDKCTRGYSGIFPDCTPCHQCFALWDVIISELTNRTH
KFLEKAKALKISGVIGPYRETVDSVERKVNEIKSILAQSPAAEPLKNIGNLFEEAEKLTK
DVTEKMSEVEANLSDTASKSNSTVQELDSLQMDAQSLDKTVKELAEQLEFIKNSDIRGAL
DSITKFFQMSLEAEERVNASTTDPNSTVEQSSLTRNKVEDLMMEREAQFREKQEEQSRLL
DELAGKLQSLDLSAVAEETCGTPPGASCAETPCGGPNCRTDDGEKKCGGPGCDGLVTVAH
NAWQKAMDFDRDVLSALAEVEQLSKTVSEAKLRADEAKQSAQAVLLKTNATKEKVDKSNE
DLRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVE
VILQQSAGDIARAEMLLDEAKRASKSASDVKDTADMVKEALEEAEKAQIAAEKAIKQADE
DIQGTQNLLTSIESETAASEETLYNASQRISELEKNVEELKRKAAQNAGEADYIGQVVNT
VKQSADDVKKVLDSELSGKYKRVENLIAKKTEESADARKKAEMLQNEAKMLLAQANSKLQ
LLKDLEQKYEDNQKYLEDKAQELVKLEEEVRFLLQDISQKVAVYSTCL
Download sequence
Identical sequences G3VPS4
ENSSHAP00000005179 ENSSHAP00000005179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]