SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005332 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005332
Domain Number 1 Region: 64-168
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-25
Family Ras-binding domain, RBD 0.0038
Further Details:      
 
Domain Number 2 Region: 1011-1122
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-23
Family PDZ domain 0.0000684
Further Details:      
 
Domain Number 3 Region: 277-386
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000000136
Family FHA domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005332   Gene: ENSSHAG00000004658   Transcript: ENSSHAT00000005385
Sequence length 1132
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841504.1:114970:199483:-1 gene:ENSSHAG00000004658 transcript:ENSSHAT00000005385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSPTMFYGSPTMSPPSKSKLKRQSRLLSHMLSRTLSYKDRSSDSTFPNLGASDDPAEL
STQLSAPGVLKVFGDNVCTGAHYKSVLATASSSAQELVKEALERYALNAVSASQYVLCDV
VGRFGGLGQQWQAEGLRVLRDNEKPLLIQDLWKPREGFSRRFELRKRSEVEELAARDVDT
ITAGINAQARKLQKNRAKGATTLTAGCKRNSTPPTLRRTVSETSLNHTSAQEEEPKGHYP
TLLDPSQSPEDPRKELPDPVLERNNSSSMRYSLYQSPHLLLLQGYSQQHDSLVYVLNREQ
HTVGQRTPSSKPSISLSAPDILPLHCTIRRLHLSSHSRHSQAEEKLILEPIPGASISINF
SEVGKTMVLHHGDLLSLGLYYLLLYKDPARAHTLPAQTLARLKAVPRTSDPITCKMCGSV
LRGRTPSSSKKHGALPSQKNPRRRLHLEFEPAVEDVLVKRIMTLIEPGGDDHKLTPAFLF
CLCIQHSATNFEPGEFGQLLLKLAKLIQRTVWEKTKELAEKQSQHQDPISLSRLTIADLL
PDLQYILFWMSNSIELLYFVQQKSPLYIQSMEEELDVRGSKESLFSSTITASEEAMTVLE
EVIMYTFQQCVYYISKSLYVSLPILLECIPFQNESRESWCSVPQLPEELRRIVSIYQATL
DLLQQYEVHPEIASQMFAYLFFFSNTLLFNQLLDKGPTLSCFHWPKGVQVCARLRQLLEW
AQSMGFGPLAEQFFKKLSCTVNLLATPSAQLIQMTWSSLRTQFPELSPAQLHRLLTQYQL
ASDIGSVTAWEPLNEDRPKAFKTEDVLESYDNHPPIVLPSGGFKVDLEVECLDDNIYRHL
LYIRHFLWSLQSKSSHARGPEPENLKGLHHTIPEGNSESPNSLVTSKDAGDHLDLKHSVG
TVARAVGEAKTLSVPTSGVSRAQSPGRTPLLEKLKPQNSMGRSSSKMNTSQGDSSCLLTP
PNTPLNFEPRSQDSLQPSGSCEKPLHELKRNGLTAQIAAQEGYTGDSPTPFDYPTPASSS
RSSATDDFCYAFVVELEKGPIGLGMGLIDGLHTPLNAPGIYIRTLIQDSPAASDGRLSLG
DRILAVNGTSLIGTDYQSAVDLIRSGGKKLRFLVAKSDIEITKKISSSASPS
Download sequence
Identical sequences G3VQ77
ENSSHAP00000005332 ENSSHAP00000005332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]