SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005585 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005585
Domain Number 1 Region: 54-182
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.31e-46
Family Regulator of G-protein signaling, RGS 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005585   Gene: ENSSHAG00000004879   Transcript: ENSSHAT00000005639
Sequence length 198
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856757.1:126763:133218:-1 gene:ENSSHAG00000004879 transcript:ENSSHAT00000005639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRTLSAFPSTCLERAKEFKTRLGIFLHKSELGTESGNVSKFEWGSKQSKEKFVPEDVLG
WKESFDHLLSSKSGIAAFRAFLKTEFSEENLEFWLACEEFKKIQSTSKLASRAQRIFDEF
ICSEAPKEVNIDHETRELTQKNLQGATTTCFDEAQGKTRTLMEKDSYPRFLRSAAYRDLV
EQACVASTSQSGGQCSHT
Download sequence
Identical sequences G3VQY0
ENSSHAP00000005585 ENSSHAP00000005585 XP_003767548.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]