SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005661 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005661
Domain Number 1 Region: 954-1168
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.39e-104
Family Thrombospondin C-terminal domain 0.00000000492
Further Details:      
 
Domain Number 2 Region: 31-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.85e-39
Family Laminin G-like module 0.0000156
Further Details:      
 
Domain Number 3 Region: 831-953
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.31e-36
Family TSP type-3 repeat 0.000000507
Further Details:      
 
Domain Number 4 Region: 762-833
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.41e-17
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 490-541
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.01e-16
Family TSP-1 type 1 repeat 0.0000809
Further Details:      
 
Domain Number 6 Region: 434-483
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000157
Family TSP-1 type 1 repeat 0.000096
Further Details:      
 
Domain Number 7 Region: 690-774
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000209
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 8 Region: 315-373
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000157
Family VWC domain 0.0047
Further Details:      
 
Domain Number 9 Region: 379-422
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000353
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 10 Region: 546-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000431
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005661   Gene: ENSSHAG00000004947   Transcript: ENSSHAT00000005715
Sequence length 1169
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856971.1:130220:177607:-1 gene:ENSSHAG00000004947 transcript:ENSSHAT00000005715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQGGRMLWWLVLLALWAFSSAQDSDGEDDTSFDLFEISNINRRTIGAKQLRGPNPSSPA
YRFIRFDHIPPVKAEILKKMLKIMRQNEGFFLTATLKQDKHSRGTLLALEGPGNSHRQFE
IISNGRANTLDLIYSGDKVQNVISLEDVDLADSHWKNITVQLTGETYSLYVDCDLIDSFI
LEEPFYEQLQAEDSRMYVAKGSIRENHFRGFLQDVHLVFETSVEDVLIKRGCERSQTAEM
NTINESTEILHLSTNIEKKTEVCERSCEELGSMINEISGLHSLVNSLRENLNKVTNDNQV
LWELVGVPLKVRNQTACWQDGRFFQDNETWVVDSCTKCTCKKFKTVCSQITCPAVTCANP
SFVEGECCPSCSPFNDNEEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLGPSIQTR
MCSLGKCDNRKRQDGGWSHWSPWSSCSVTCGLGNITRIRLCNSPVPQLGGKTCKGSGRET
KECEKSPCPINGRWSPWSPWSSCSVTCAGGIRERSRICNNPEPQYGGKDCVGDVKEHQMC
NKRSCPVDGCLSNPCFPGAECNSFPDGSWSCGSCPVGYLGNGTHCEDLDECTVVTDVCFI
SSKVHRCVNTNPGFHCLPCPPRYKGTQPFGVGLDAARTEKQVCEPENPCKDKTHNCHKHS
ECIYLGHFSDPMYKCECKTGYAGDGHICGEDSDLDGWPNKNLVCATNATYHCIKDNCPHL
PNSGQEDFDKDGIGDACDTDDDNDGVDDEKDNCPLLFNPRQSDYDKDEVGDRCDNCPYVH
NLAQIDTDNNGEGDACSVDIDGDDIFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLMHN
PDQTDVDNDLVGDQCDNNEDIDEDGHQNNQDNCPYISNANQADHDNDGKGDACDSDDDND
GIPDDRDNCRLVFNPDQEDSDGDGRGDICKDDFDNDNVPDIDDVCPENNAISETDFRKFQ
MVHLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDD
YAGFVFGYQSSSRFYVVMWKQVTQTYWENQPTRAYGYSGVSLKVVNSTTGTGEHLRNALW
HTGNTKGQVRTLWHDPKNVGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYDQ
TYAGGRLGLFVFSQEMVFFSDLKYECRDV
Download sequence
Identical sequences G3VR56
ENSSHAP00000005661 ENSSHAP00000005661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]