SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005662 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005662
Domain Number 1 Region: 929-1143
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.39e-104
Family Thrombospondin C-terminal domain 0.00000000492
Further Details:      
 
Domain Number 2 Region: 804-928
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.36e-33
Family TSP type-3 repeat 0.000000533
Further Details:      
 
Domain Number 3 Region: 25-206
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.35e-32
Family Laminin G-like module 0.0000451
Further Details:      
 
Domain Number 4 Region: 735-806
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.49e-17
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 463-514
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 9.81e-17
Family TSP-1 type 1 repeat 0.0000809
Further Details:      
 
Domain Number 6 Region: 407-456
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000157
Family TSP-1 type 1 repeat 0.000096
Further Details:      
 
Domain Number 7 Region: 663-747
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000196
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 8 Region: 288-346
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000136
Family VWC domain 0.0047
Further Details:      
 
Domain Number 9 Region: 352-395
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000034
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 10 Region: 519-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000526
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005662   Gene: ENSSHAG00000004947   Transcript: ENSSHAT00000005716
Sequence length 1144
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856971.1:130220:177607:-1 gene:ENSSHAG00000004947 transcript:ENSSHAT00000005716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWWLVLLALWAFSSAQDSDGEDDTSFDLFEISNINRRTIGAKQLRGPNPSSPAYRFIRF
DHIPPVKAEILDKHSRGTLLALEGPGNSHRQFEIISNGRANTLDLIYSGDKVQNVISLED
VDLADSHWKNITVQLTGETYSLYVDCDLIDSFILEEPFYEQLQAEDSRMYVAKGSIRENH
FRGFLQDVHLVFETSVEDVLIKRGCERSQTAEMNTINESTEILHLSTNIEKKTEVCERSC
EELGSMINEISGLHSLVNSLRENLNKVTNDNQVLWELVGVPLKVRNQTACWQDGRFFQDN
ETWVVDSCTKCTCKKFKTVCSQITCPAVTCANPSFVEGECCPSCSPFNDNEEGWSPWAEW
TECSVTCGSGTQQRGRSCDVTSNTCLGPSIQTRMCSLGKCDNRKRQDGGWSHWSPWSSCS
VTCGLGNITRIRLCNSPVPQLGGKTCKGSGRETKECEKSPCPINGRWSPWSPWSSCSVTC
AGGIRERSRICNNPEPQYGGKDCVGDVKEHQMCNKRSCPVDGCLSNPCFPGAECNSFPDG
SWSCGSCPVGYLGNGTHCEDLDECTVVTDVCFISSKVHRCVNTNPGFHCLPCPPRYKGTQ
PFGVGLDAARTEKQVCEPENPCKDKTHNCHKHSECIYLGHFSDPMYKCECKTGYAGDGHI
CGEDSDLDGWPNKNLVCATNATYHCIKDNCPHLPNSGQEDFDKDGIGDACDTDDDNDGVD
DEKDNCPLLFNPRQSDYDKDEVGDRCDNCPYVHNLAQIDTDNNGEGDACSVDIDGDDIFN
ERDNCPYVYNTDQRDTDGDGVGDHCDNCPLMHNPDQTDVDNDLVGDQCDNNEDIDEDGHQ
NNQDNCPYISNANQADHDNDGKGDACDSDDDNDGIPDDRDNCRLVFNPDQEDSDDIGDGR
GDICKDDFDNDNVPDIDDVCPENNAISETDFRKFQMVHLDPKGTTQIDPNWVIRHQGKEL
VQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQT
YWENQPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTKGQVRTLWHDPKNVGWKDYT
AYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYDQTYAGGRLGLFVFSQEMVFFSDLKYE
CRDV
Download sequence
Identical sequences G3VR57
ENSSHAP00000005662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]