SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005782 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005782
Domain Number 1 Region: 201-511
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.06e-40
Family Galactose oxidase, central domain 0.013
Further Details:      
 
Domain Number 2 Region: 616-791
Classification Level Classification E-value
Superfamily C-type lectin-like 7.26e-27
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 3 Region: 2-115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-20
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 928-974
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000301
Family Laminin-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005782   Gene: ENSSHAG00000005043   Transcript: ENSSHAT00000005836
Sequence length 977
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834463.1:136109:324026:-1 gene:ENSSHAG00000005043 transcript:ENSSHAT00000005836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYA
PLIAVLSGLIVPEVRGNETVPEVVTTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSG
HGKCTTSVSIPSRVYCECDKYWKGEACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQE
IGPDCSLNVPSTESYWILPNVKPFSPSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLN
YNLESSIWNVAPISRGPLQRYGHSLALYQENIFMYGGKIETNNGNVTDELWVFNIHSQSW
STKTPTVLGHGQQYAVEGHSAHIMELDSRDVVMIIIFGYSAVYGYTSSIQEYHILSNTWL
VPETKGAIVQGGYGHTSVYDEMTKSIYVHGGYKALPGNKYGLVDDLYRYEVNTKIWTILK
ESGFARYLHSAVLINGAMLIFGGNTHNDTSLSNGAKCFSADFLAYDIACDEWKILPKPNL
HRDVNRFGHSAVVVNGSMYIFGGFSSVLLNDILVYKPPNCKAFRDEELCKNAGPGIKCLW
NKNNCESWEAGHHNNILRAKCSAKTVATDDRCYRYADCASCTANTNGCQWCDDKKCISAN
SNCSMLRVSVKNFTKCHVKNEQICNKLTSCKSCSLNLNCQWDQRQQECQALPAHLCGEGW
NHIGDACLRINSSKENYDNAKLYCYSLNGNLASLTSSKEVEFVLDEIQKYTQQTFHSKFK
VSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGEPNDSGFCAYLERAEVAGLKANPCTSV
ADGLVCEKPVVSPNQNARPCKKPCSLRTTCSNCTSNGMECMWCSSTKRCVDSNAYIISFP
YGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGWCNDPSNTGKGHCIEGSSRGPMKVIGM
HTNEMILDTSLCPKEKSYEWSFIYCPACQCNGHSTCINNNVCEQCKNLTTGKQCQDCMPG
YYGDPTNGGQCTVCFCN
Download sequence
Identical sequences G3VRH7
ENSSHAP00000005782 ENSSHAP00000005782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]