SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005817 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005817
Domain Number 1 Region: 16-143
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.89e-25
Family Calponin-homology domain, CH-domain 0.00068
Further Details:      
 
Domain Number 2 Region: 998-1087
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000002
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005817   Gene: ENSSHAG00000005077   Transcript: ENSSHAT00000005871
Sequence length 1670
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849869.1:137631:393475:1 gene:ENSSHAG00000005077 transcript:ENSSHAT00000005871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGREDAESNCDVAFAEAQRWVEAVTEKNFENKDFRASLENGVLLCDLINKLKPGIIKKI
NRLSTPIAGLDNINVFLKACEKIGLKEAQLFHPGDLQDLSNRVTVKQEETDRRVKNVLIT
LYWLGRKAQSNPYYNGPYLNLKAFENLLGQALTKALEDSSSLKRSGRDSGYGDIWYTERG
EFLSPSAYHKRDDSFDSLDSFGSRSFTSCSSDLTLKGGSEGCESDTDSELTFKMQDYNKD
DMSYRRISAVEPKSALPFNRFLPNKSRQPTYVPAPLRKKRPDKNEDNRRSWASPVYTEAD
GTFSSKQRRKWDSKVENRPAIKETSNSSSYLEEEEEEEEEEDEKATGMPNIVKDDLYVRK
LSPIVPTAGSDFDKFLPKSWIPEDVNWKRIKKTTSYKPWYKEFQGFSQFLLLQALQTYSD
DILSDETKTKVDPTSGPRIITCRRNVFYAPGYRRNDTENGVLDPDLENDDYFVRKTGAFH
ANPVVLQTFEDFRRFAVPDDFIERDIILQQREGEPVLPDLEKDDMIVRRIPTQKKDVPLS
GAPDKYHPVPFPEPWTLPPEIRARFLCVLERTSPSKDKNNSCRVLVPSSCQKKDDMLTRK
IESWKLGTTVPSISFTPGPCSEEDLKKWEAIRAASKVRHKKRQMVERLFQKISDENGSKS
LSDITAEDVHNMRQLRYEEMQKIKSQLQEQDQQWQDDLAKWKNRRKSYTSDLQKKKEERE
EIEKLSLERSQRSSKTFGEILQDREIRNQETNSHRWKTFDSERMYSNDEIFNEAKMSPVP
TLTRESYLNEGREKEVTYSSERSKEDSSNLPKMENYETAEIQVPSQSLTEKQSSASALSS
NHSLNTQMGPARVSASLPRSYQKTDTSRLTSVVTPRPFGSQSRGISSLPRSYTMDDAWKY
NGDVEVTKIIPETSKSSSFSKSDDNQLHSSSALTSVEEGAKESEKKTLPATPLYLPISQE
HEAFPKSEQPLTSDSLPVSGSLEGKNSSSPEPSRTKDQFSDMRIIMIHRPGNSDPDFGFT
VRWDISGIIVQSVEAGSPAALSQLQVDDEIIAVNNTKFSNKDTDKWEEIMANARETGNLV
VDVRRYGKNGSPETKWIDATSGVHHTDKASNLSIRSNFSESLQNSNMETKGINGISDENS
STEPKASEPISLKNLKRRSQFFEQGSSDSMVPDLPVPTINAPSRWAWDQEEERKRQEKWQ
KEQDRLLQEKYQREQEKLREEWQRAQQEAEKENSKYLDEEQMVLNSNSVSLTSREPTLAN
CERNWREEIYPSEREKNRAEEEERLHHEEQKRKLEEQLLLEKERKIKELEEVQQKQRAEL
EEQKRQAEIEEQRRRAEIEEQGRRAEIEEQRRRAEIEEQRRRAEIEEQRQRAEKEKETSV
QIYQYKRPVDPFEVSKREESTNLLPSDRDKSRSTTELDQPTSRNGSNKYFDRIGNVGYSQ
KSSRKEQTTSEAEMERQQILQEMRKKTSLHNDNSWIRQRSSSVTKEPICLPGIMRRGESL
DNLDSPRSNSWRHAPWMNQSTGFHTSSSVQDFSRPPPQIVSTSNRAYMRNPSSSLVPSSV
GSIRTGSLSSAPSPAPRTQSPSTTQSGMQQRNRYVTQMETHSYLQFLLGKGKKFLWALLH
NGYRLFPFQCVACECDLGGSSSGAEVRIRNNELYCNECYLRFKSGQPTSM
Download sequence
Identical sequences G3VRL2
ENSSHAP00000005817 ENSSHAP00000005817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]