SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006183 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006183
Domain Number 1 Region: 35-125
Classification Level Classification E-value
Superfamily PDZ domain-like 9.05e-25
Family PDZ domain 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006183   Gene: ENSSHAG00000005380   Transcript: ENSSHAT00000006237
Sequence length 140
Comment pep:known_by_projection scaffold:DEVIL7.0:GL867618.1:155037:158480:1 gene:ENSSHAG00000005380 transcript:ENSSHAT00000006237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGQIPYDDYPVVFLPPYENPPAWIPPHERVYHPDYNNELTQFLPRTIMLKKPPGAQLGF
NIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNEVDFQDIEHSKAVEILKTAREI
SMRVRFFPYNYHRQKERTVH
Download sequence
Identical sequences G3VSM8
ENSSHAP00000006183 ENSSHAP00000006183 XP_003775004.1.9362 XP_012408860.1.9362 XP_012408861.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]