SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006353 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006353
Domain Number 1 Region: 3283-3394
Classification Level Classification E-value
Superfamily Cadherin-like 2e-28
Family Cadherin 0.00092
Further Details:      
 
Domain Number 2 Region: 2232-2339
Classification Level Classification E-value
Superfamily Cadherin-like 5.1e-28
Family Cadherin 0.00098
Further Details:      
 
Domain Number 3 Region: 2758-2866
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-27
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 2973-3081
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 5 Region: 998-1101
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 3074-3178
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-25
Family Cadherin 0.0029
Further Details:      
 
Domain Number 7 Region: 2025-2132
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 8 Region: 1510-1619
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-24
Family Cadherin 0.0019
Further Details:      
 
Domain Number 9 Region: 421-521
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-24
Family Cadherin 0.00069
Further Details:      
 
Domain Number 10 Region: 3735-3915
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-24
Family Laminin G-like module 0.0054
Further Details:      
 
Domain Number 11 Region: 1719-1839
Classification Level Classification E-value
Superfamily Cadherin-like 7e-24
Family Cadherin 0.0023
Further Details:      
 
Domain Number 12 Region: 3382-3499
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-23
Family Cadherin 0.001
Further Details:      
 
Domain Number 13 Region: 786-889
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-23
Family Cadherin 0.00071
Further Details:      
 
Domain Number 14 Region: 891-994
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-22
Family Cadherin 0.0028
Further Details:      
 
Domain Number 15 Region: 2868-2979
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 16 Region: 691-784
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-19
Family Cadherin 0.0024
Further Details:      
 
Domain Number 17 Region: 1403-1516
Classification Level Classification E-value
Superfamily Cadherin-like 2e-19
Family Cadherin 0.0017
Further Details:      
 
Domain Number 18 Region: 2132-2239
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-19
Family Cadherin 0.0028
Further Details:      
 
Domain Number 19 Region: 2442-2552
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-19
Family Cadherin 0.0014
Further Details:      
 
Domain Number 20 Region: 2339-2436
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-18
Family Cadherin 0.0014
Further Details:      
 
Domain Number 21 Region: 1623-1725
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-17
Family Cadherin 0.0021
Further Details:      
 
Domain Number 22 Region: 2542-2648
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-17
Family Cadherin 0.0021
Further Details:      
 
Domain Number 23 Region: 2656-2765
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-16
Family Cadherin 0.0029
Further Details:      
 
Domain Number 24 Region: 3181-3289
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-16
Family Cadherin 0.0048
Further Details:      
 
Domain Number 25 Region: 533-632
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000728
Family Cadherin 0.0015
Further Details:      
 
Domain Number 26 Region: 125-201
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000657
Family Cadherin 0.0048
Further Details:      
 
Domain Number 27 Region: 1103-1181
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000885
Family Cadherin 0.0028
Further Details:      
 
Domain Number 28 Region: 1827-1949
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000557
Family Cadherin 0.0047
Further Details:      
 
Domain Number 29 Region: 1317-1415
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000328
Family Cadherin 0.0091
Further Details:      
 
Domain Number 30 Region: 1935-2037
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000328
Family Cadherin 0.0052
Further Details:      
 
Domain Number 31 Region: 336-433
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000589
Family Cadherin 0.0067
Further Details:      
 
Domain Number 32 Region: 3918-3954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000676
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 33 Region: 3496-3587
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000101
Family Cadherin 0.013
Further Details:      
 
Domain Number 34 Region: 3957-3992
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000173
Family EGF-type module 0.02
Further Details:      
 
Domain Number 35 Region: 32-126
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000243
Family Cadherin 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006353   Gene: ENSSHAG00000005530   Transcript: ENSSHAT00000006408
Sequence length 4323
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834605.1:164308:234829:-1 gene:ENSSHAG00000005530 transcript:ENSSHAT00000006408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIIVLAFVLLLLHCLSCERLQESPSLSSIHFTQPIYNGTIYENSAPKTYVETLGKMGIY
LAEPQMVVRYRIVSGDLANVFKTEEHVVGSFCFLRIRTKSGNTAILNREVCDSYTLVIQA
TEQTPPSYKVAIPEDTPLKSAICMVSATDADLGQNADFYYAFNARSELFTVHPTSGVVTV
TRKLNATWKGRHELQVLAVDRMRKISEGNGFGNLASLVIQVDPSPKKPPAISSVVVTTQD
ETGDNAYATLTVDANGSEAGVEVVNIVDGDPGKHFKVIKSYGGSNKFTLVAIKDIDWLEY
RHGFNLSLQAKDGGKPPLYSQIRGIHLPPSKIASARFEKATYRVQLSEISPPGTYVVVVK
VTPTFPSLQYILKSTSESSGFKINSRTGLITTTRLMDYHDRARYQLHVGTTLGQTSTIVV
IDIIDCNNHAPVFSQSSYHGTFDENLPPGTSVLTVTATDQDHGENGFVTYSITSPRIVPF
TIDPYLGVISTSKLMDYELMQRLYTFRVWATDWGSPFRRESEVSISLMLNNLNDNQPMFE
NANCNGTVPWDLRVGETVVTLSAIDMDELMNLRYEIVSGNELEYFDLNHFSGVVSIKRSF
KNLPPGQHYSLEITASDGDNYALPTSLNVTVVASGSSVHVQCEETGVLKHLTETIIHSVG
SQIQEPSSEEFTSLSTYHINHYTPQFEDHFPQSIDILEGVPINTTVAHLAAFDLDAGFNG
KLVYVLAGGNEESRFDVELETGLLKVAAPLDHEATSFYILNVTVYDLGTPQKSSWKQLAV
NVGDENDNTPKFPAGGYQVEIREDTEMGTTIAQLKAEDADKDDNGRVCYTLLNPTDQFSL
HALTGEVVVTGPLDRESQPQYVLKIEARDQANVGPQLFSVTNLVVTLSDVNDNTPQCIPE
LSQVKIPEDLPLGTVLTFLEAFDPDLGPGGEVKYTLMDDAQGTFGLDPLTGALSLERELD
FEKRTWYNLSLWASDGGKPIARGASCHVQVTVLDVNENLHPPRFASFVYQGQVEENSLPG
TLVLSVTAQDVDLGQDGVIQYFLRDGTDLATFSIDRDTGMIQTIMPLDREFIPHYWLTVL
AVDQGSVPLSSVTEVYIEVMDTNDNPPQMSRPVYYPSVKEDAPMNTSVLQLDAWDPDTVS
KGKLTFHIISGNNLGFFVINSLTGPGSIYCQQFLDRDIWHSSLQDKGVPGLPLSTQLKIM
LGEKNQNKSIMEHVVPNLGLELCLKDLSEEGCFRGYCCDTMEKISNAISYSAEYFKEKGV
KWGALGDLGRKRMFGTSGVELLNIQAVDNGQPPRFSSVRLHIEWIPRPSPSGKLWAFDEP
HYNFAAMETDPVNHMVGMVSVEDPPGLLWFNISGGDEDMDFDIEMTTGSMVIARHLDSRR
KASYNLTVEVTDGSRTITTQVFIHLISINQHRPQFLEAQYEVKVPQDTPPGLELLRVQAT
DQDKGKSLVYMIQGSVDARSSKLFQLDPSSGSLVTVGKLDLDSGLSRHVLTVMVRDQEIP
IKRNFVWVIIQIEDRNLHPPSFTQLHYETTTSNTASLGTELLQVRALDVDRGFNGQVQYS
LQAGNSESFFNIDPHLGIITVAQKLDLMPQDQYMLTVRAEDQGSPPLHDMATVTIHIHPS
DYSAPVFSMAEYFAEIPESVAIGSPLLLVSAVSTSEVTYEMREGNKDGVFSINSYSGLIS
TQKSLDHEKVSSYQLKIRGSNMAGAFADVMVLVYIIDENDNTPVFINSSFVGYISEAAPI
HSMILDEYNHPLVVRATDADTDTNALLVYEILEREALKFFKIDPSMGTLTTVMEMDYEHI
SSFSLTIHVHDQGNPILFASKPARVTIHVKDVNDSPPVFSKAIYEVTVLLPVHPGMELLQ
VQAVDADSKVTYNIIAGNANDAVFLHPVTGIISVVNVALLGHSCDLSVKAFDGLYHDISV
VKINLTEAPVTALKFARDVYMVTVKENSWDTQALIILGVNGSQFNDTLSFSVLNGTDVFQ
MIHSVGVLQTKGVAFDREQQDTYEVAVEVRDDRHPPRVAQATVKVSIEDVNDNPPEFNHL
PYYTAIQDGTEPGDVLFQVSATDLDLGDNGTITYAFAEDYVYFWIDPYLGDISLKKPFDY
QALNKYTLRVIARDGGNPSLQAEENVLVIVRNKSNPLFQSLHYKVQIPENIALYTPILHT
QARSPEGLRLIYNIMEEESLTLFTADFKTGVLTVTGPLDYESQTKHIFTVRATDTALGSF
SEATVEVQVEDINDNPPIFTQLVYTALVSEGLPAQTPVIKLLASDKDSGRNKDVSYSMVE
DESEDSSFFQIDKSTGEMSTAQELDYETQQQFHVKVRAVDNGIPPLSAEALVIVNVSDVN
DNPPAFRQPQYEANVSELASCGHLVIKVQALDPDSGDTTRLEYLILSGNEDRHFIINRTS
GIISMFNFCRKHLDPAYRLRVAASDGVFRTAVPVYINTTNANKYSPEFRQHIYEVELAEN
AEIGTKVIELLAVDPDDGPYGTIDYTIINKLASEKFSINSRGQITTLQKLDRENATEKFM
PIKVMARDGGGKVAFCSVKTILTDENDNPPQFKASDYTVSVQSNVSKGSPVIQVLAYDAD
EGANADVTYSVDSMEDLGEEVIEVNSVTGVVKVKESLVGLENQAFNFKIKAQDGGPPHWD
SFIPVRLQVVPNEVTLPKFSEPSYTFSVSEDLPEGSEVGLVKAVAEDPIIYSLVKGTTPE
SNKDGVFSLDQETGALKVRKPIDYETTKWYQIDVMANCSHKETGLITLASVNIQVKDVND
NKPVFEADPYKAFLTENMPVGTTVIQVTANDQDTGVNGEVTYSLAFEQGNAAAELFAINS
ENGWITTRQELDCEIQETYRFYVVASDHGRTIQLSSQALVEVTITDENDNAPQFASDVYK
GSVIENGDPGEHVVTLRTLDADISEQNRQVTCYITEGDPLGQFDISQTADEWKISTKKIL
DREHIAKYLLKVTASDGKFQASIPVEVFVLDINDNSPQCTQILYSSKVPEDMLPGHFILQ
VTATDLDAGVNAQVTYSLHGPGADEFKLDPYTGELTTLMPLNREEKDVYHLVAKATDGGG
RSCQADAIIRVEDVNDNAPRFFPNHCSVAVFDNTTVKTPVAVVFARDPDEGVNAQVSYSL
VGSADGYFSIEATTGVIRLEKPLRARQQEVLELTVRASDQGTPTPLSTLGTVTVSVVDLA
DYLPVFLSTEHSVQVSEDARPGTEVLHLGPLTREGAEKTGYQIVSGNEQEKFRLDYHTGI
LYVNGSLDFETGQEYYLSIECIRKSSPSLNDGTIVVVNITDVNDHPPKFLQDLYSVEVKE
DAAVGESILTVSATDGDGPLNSAITYSLVAGDRLGHFTIHPKKGELQIAKHLDWEETSSY
FLTLRATDSGQPALYQDVEVDVQVADVNDNPPRFFQLNYSIVVQENAPLGSRVLELILSD
QDSPKNGPPYSFRITEGNDGSAFRVTEDGWLVTAAALNRRFKEQYLLQIQVSDSGVPPLS
SSAFVNAQVTEQSQYPPSALPLEIFITTGEQTFQGGVVGKIHATDRDPRDTLTYRLMDKK
PTHSYFSVGVADGKIIANEGLPHGHYSLKINVSDGTFVTSAGVQVHVWHAAPEAQAHTVL
LQFRHLSPEEFVGDHWRNLQRFLGSALGFERQHIYPVSLQPAEEAVGIDLLLAFEEALGS
FHEPRSLADSIARRAREMEHSVGIHLTKVVPVVLCQGPGCQEHTCTETLQLDSGAVSTYS
TARISILTPKYSLRLNCSCNDTAARFGSQSLVQYKHPFAQNWHIRLQMKTQQPHASLLFL
NWSTVAFLELADGMPRLEYHCQGGFQGNLSSTFYVSDQEWHLVLLEVTGMSIRLQIDNKG
NTSTVLPEHCRSPQIGGDLFLGGHIRPHLLQQTSKAFQGCVKDIVVNREELELLSNNHKK
RASFLKGVALTQCCPQGNVCSLNPCLNGGQCSETSRGGYKCMCPASFSGDHCELSGGSCE
SRSCLNGGNCVPKAGGASCSCLYPYTGDRCEEMAECSNGPCETTTQTTAHQEWGYGQQEI
KIIAVGVACIVVILIAFMVLCYYCHPDKTHRPVAKDDPDLFAKSVGVDTQTMPIELNPLD
SGSHNNLDCAGPEAHKTSVTPEFLTFGPGPGQRQRSMIVCSVAPNLPPAAPPSNSDNESV
VKSTWAGEEMVYPAEATFWAPAYAPAELQDYPRYEVIQAPLPASPHRAPPPSVEPEPSTL
YGGFPFPLESTNKRAPIPPRYSNQNLEDFLPLPAPNPDPRERPHSPCPNEYTAISYYPSH
LLQPGGPLYPVEGAYKRVSVRLSVAQPSYADCEVVPCPPGRPLHYEGSDMIESDYGSCEE
VMF
Download sequence
Identical sequences G3VT48
ENSSHAP00000006353 ENSSHAP00000006353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]