SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006463 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006463
Domain Number 1 Region: 693-801
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-23
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 2 Region: 179-304
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-19
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 140-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000335
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 553-689
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000121
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 5 Region: 2-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000455
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 6 Region: 509-560
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000837
Family Growth factor receptor domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006463   Gene: ENSSHAG00000005626   Transcript: ENSSHAT00000006519
Sequence length 879
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861547.1:170260:351563:-1 gene:ENSSHAG00000005626 transcript:ENSSHAT00000006519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSYECQCREGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKGGVACECRPGFEL
AKNQRDCTLTCNYGNGGCQHTCDDTDTGPVCGCHQKYALHSDGRTCIEKDEAAIESTEFN
TTSVADVDKRVKRRLLMETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPDGKTCKDIDE
CLVNSGGCDHFCRNTVGSFECSCQKGYKLLTDERTCQDIDECSFERTCDHTCINSPGSFE
CLCHRGYTLYGLTHCGDVDECSINNGSCDYGCINTMGSYECACPPGRKLHWNKKDCVETV
KCLPGAKTTPRIQLTCSRTGGLETCFLACPSNTLFIPDSENGYSLSCGIPGQQGKSQQKR
NSTVPSCTDPLVPPVKQKARFKIRDAKCHLRRRSKDKVKEVGKQALLDNCQVTFVNLQCD
SSKKKRRGRKSPSKEVSHITAEFEVEMKSDEVSDTCNTDCVRKKLEQKLQAAIKTLRKSI
NKQQFYLQFSGTEYEVAQKPAKTAEGQEACSPGLVLQDGKCVTCGPGTYYSGEHSECLPC
LPGTYQDTEGQLTCEPCPSNDGQGLAGARNVSECGGQCSPGFYSSDGFKPCRPCPLGTYQ
PEPGRTLCFPCGGGLVTKYEGAVSFQDCETKVHCSPGHYYNSSTHRCIRCPIGTYQPEFG
QNYCITCPGNTSTDFDGSTNVTHCKNQHCGGELGDYTGYIESPNYPGDYPANVECIWNIN
PPPKRRILIVVPEIFLPIEDECGDVLVMRKSASPTSITTYETCQTYERPIAFTSRSRKLW
IQFKSNEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDV
LAHPQNYFKYTAQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences G3VTF8
ENSSHAP00000006463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]