SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006550 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006550
Domain Number 1 Region: 6-280
Classification Level Classification E-value
Superfamily L domain-like 4.25e-50
Family Leucine rich effector protein YopM 0.065
Further Details:      
 
Domain Number 2 Region: 236-392
Classification Level Classification E-value
Superfamily L domain-like 4.25e-31
Family Internalin LRR domain 0.013
Further Details:      
 
Domain Number 3 Region: 836-948
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-27
Family PDZ domain 0.0000919
Further Details:      
 
Domain Number 4 Region: 971-1082
Classification Level Classification E-value
Superfamily PDZ domain-like 8.54e-27
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 713-809
Classification Level Classification E-value
Superfamily PDZ domain-like 7.36e-25
Family PDZ domain 0.000032
Further Details:      
 
Domain Number 6 Region: 1080-1179
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-23
Family PDZ domain 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006550   Gene: ENSSHAG00000005699   Transcript: ENSSHAT00000006607
Sequence length 1625
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841405.1:175888:247324:-1 gene:ENSSHAG00000005699 transcript:ENSSHAT00000006607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCIPLWRCNRHVESVDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQVLPGDVGNLANLVTLELRENLLKSLPTSLSFLVKLEQLD
LGGNDLEVLPDTLGALPNLRELWLDRNQLSTLPPELGNLRRLVCLDVSENKLEHLPAEVS
GLTLLTDLLLSQNLLERLPDGIGQLKQLSILKVDQNRLCEVTEAIGECENLSELILTENM
LTALPRSLGKLTKLTNLNVDRNRLGTLPAEVGGCTSLNVLSLRDNRLASLPPELAGTTEL
HVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLKFQTEDDQKTGEKVLTCYLLPQQP
SPSLDTLLQSSLDESWSGSHSHVNRVSVIQFLEDPVGMEDEDPGAEKRSLQRRATPHPSE
LKVMKKVIEDRRNEAYIAKPDSEQMSPTEEEKRLSSQSHQSMDSHVSTSTASAGFLEDEE
EEVEQKQGQTSERDSSHRANEEDMEIMATGHEEEVEDEYEEPTVHFAEDTLVRSEDEDEA
EELRPPPGERQRLIRKDTPHYKKHFKITKLPRPEAVVALLQGLSGDGDGELAPTGCSNGP
HAPHEQLSLPWGQHAEMNKEEDNEPDEEKNGAVTAPPSVKGVSFDQANNLLIEPARIEEE
ELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNG
VTLQGAEHHEAVEALRGAGGAVLMRVWRERMVEPENAITVTPLRPEDDYSPRERRGSSLR
LPEPSSPPGPPRQRHTTFLVRSERGLGFSIAGGKGSTPYRAGDGGIFISRIAEGGAAHRA
GTLQVGDRVISINGVDMTEARHDQAVALLTAASPTITLLLEREADGPLTPAPSLSSPSPP
SPVTPMAVGEPGPPSNLMATTLEGPYPVEEICLVKAGGPLGLSIVGGSDHSSHPFGIQEP
GVFISKVLPRGLAARSGLRVGDRILAVNGQDVRGATHQEAVNALLSPSPELCLLVRRDPP
PPGMKEICIEKAPGEKLGISIRGGAKGHAGNPFDPTDEGVFISKVSPAGAAGRDGRLRVG
MRLLEVNQQSLLGLTHTEAVQLLRGVGDALSVLVCDGFDPVAAAALEMSPGVIANPFAAG
IGRKNSLESISSIDRDVSPEDLDKTLSPEPLRLDYRTLAALPGSSSIQRINSRVSPGAIG
NPLDAPRSPSSQQASISFLPSQEEHKSVVPPGNAASPEQLSFRERQKYFELEVRPPQADG
PPKRVSLVGEDDLKKMKEEEARKLQQKRALLLQEEEEEEAEEVVAPAPAPVEGLESPGEQ
KSCLPQTEPSNSQRNSLEEGPQQELRSSYSARLSPMSLGAGELGAPVRTAKAERRQQERL
RMQSPELLSGPERELSPAERRALEAEKRALWRAARMKSLEQDALRAQMVIAKSQEGRGKR
SPLGQLTEAPSPAPTPSPTPLEDLSPRIVTSPGRLSLSEKKFDYREFAALPSSRPVYDIQ
SPDLPDELKYLEDSLSPGHQEEDGEVEQVLLGPPGPSPMALEEVTLCSTRRKLRHERRGL
DPVPS
Download sequence
Identical sequences G3VTP5
ENSSHAP00000006550 ENSSHAP00000006550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]