SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006651 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006651
Domain Number 1 Region: 967-1180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-105
Family Thrombospondin C-terminal domain 0.00000000157
Further Details:      
 
Domain Number 2 Region: 37-241
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.89e-39
Family Laminin G-like module 0.0000000181
Further Details:      
 
Domain Number 3 Region: 844-966
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.62e-37
Family TSP type-3 repeat 0.000000135
Further Details:      
 
Domain Number 4 Region: 499-556
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.75e-16
Family TSP-1 type 1 repeat 0.0000196
Further Details:      
 
Domain Number 5 Region: 445-494
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000157
Family TSP-1 type 1 repeat 0.0000421
Further Details:      
 
Domain Number 6 Region: 773-846
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000235
Family TSP type-3 repeat 0.00022
Further Details:      
 
Domain Number 7 Region: 326-384
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000303
Family VWC domain 0.0039
Further Details:      
 
Domain Number 8 Region: 703-787
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000549
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 9 Region: 389-438
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000209
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 10 Region: 559-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000304
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006651   Gene: ENSSHAG00000005788   Transcript: ENSSHAT00000006709
Sequence length 1180
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834508.1:181379:195663:1 gene:ENSSHAG00000005788 transcript:ENSSHAT00000006709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLDTNSSIMGLARWLVLTLLLKVCGTNRISESGSDNSVFDLFDLPGAANKGSGRRLVKGP
DPSSPAYRIEDANLIPSMPEDKFQDLVDAIRAERGFIFLASLRQLKKTRGTLLTVEYKDH
SGHIFSLVSNGKAGTLDLSMSVQGKQQVVSVEEALLATGQWKSIILFVQEDRAQLYVGCE
KMENAELDAPIESIFTRDLAGSARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGC
SSSTNQIITLDNPVNGSSPAIRTNYIGHKTKDLQAICGFSCDELANMFLELKGLRTIVTT
LQDSVRKVTEENELLSNVVKKAWSYPGCSYNGVKYNNNDMWTIDSCTECHCQNSVTMCKK
VSCPLMPCSNATIPDGECCPRCWPSDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLN
NRCEGSSVQTRICHIQECDKRFKQDGGWSHWSPWSSCSVTCGSGEITRIRLCNSPSPQMN
GKPCEGEARETKACQKDACPINGGWGPWSPWDICSVTCGGGLQKRSRLCNNPKPQFGGKD
CVGDATGSQICNKQDCPIGTDGCLSNPCFAGAKCTSYPDGSWTCGACPPGYTGNGIQCKD
VDECQEVPDACFNHNGVHRCENTDPGYNCLPCPPRFTGSQPFGRGVEHATANKQVCKPRN
PCTDGTHDCNKNAKCNYLGHYSDPMFRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVAN
ATYHCKKDNCPNLPNSGQEDYDKDGIGDACDNDDDNDKIPDDRDNCPFHYNPAQYDYDRD
DVGDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDG
VGDQCDNCPLEHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKD
GKGDACDHDDDNDGVPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPE
NYDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAIGFDEFNAVDF
SGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQLTQSYWDSTPTIAQGYAGLSVKVVNS
TTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEG
KKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECR
Download sequence
Identical sequences G3VTZ6
ENSSHAP00000006651 ENSSHAP00000006651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]