SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006673 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006673
Domain Number 1 Region: 65-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000838
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006673   Gene: ENSSHAG00000005806   Transcript: ENSSHAT00000006732
Sequence length 655
Comment pep:novel scaffold:DEVIL7.0:GL841657.1:183089:218871:1 gene:ENSSHAG00000005806 transcript:ENSSHAT00000006732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSLSGLFILLVTATAQTQGGKSISCPQCPQHSSCINGISCICQDGYASESGNIFFTDPR
EICKDINECDDNPAICKGKSCINYDGSYQCSCYSTYSGIHAFLSFFRACPETFEGLAQER
RAEQDKINVLQIFENILNIFNTPFGGNKSAIARSVTNLLQRMEIMILESAFKPQNRIQDR
YLVTDTQVVPNNNCSERNKIFTLKAGEDAMNIPCNEVIRGSTKGQSAVAFLSYTMLGNII
NGSFFEEERHLQKASNISLNSRVVSGTTGQRQNSTLTSSVILTFKHLQESYNQGYKFLCV
YWKSTTEGANWSTEGCSLLKTNATHTSCNCGHLSTFAVLMALTDQVEDGVLTAITYVGLG
LSLLCLFLAALTFFLCRAIQGTSTSLHLQLSLCLFLADLLFLTGIHQTANKILCSIIAGT
LHYLYLAAFTWMFLEGLYLFLTVRNLKVANYTSARHFKKRFMYPFGYGIPAGIVAISTGI
DPHGYGTIKYCWLNLQRGFIWSFVGPVMVIILFNLIFYSITLWILRDTLSSLNKDVSTIQ
NTRILTFKALAQFLILGCSWSLSFFLTKSITEPAQSIIAYTFTITNSLQGIYIFLVHCIL
NSQVQEEYRKLFKGIQKISETDSSDMLSGRTTHSKVIVELEKSPKFVGKGKNTLT
Download sequence
Identical sequences G3VU18
ENSSHAP00000006673 ENSSHAP00000006673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]