SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006685 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006685
Domain Number 1 Region: 42-173
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.32e-48
Family Regulator of G-protein signaling, RGS 0.00000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006685   Gene: ENSSHAG00000005818   Transcript: ENSSHAT00000006744
Sequence length 180
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856757.1:183660:217013:-1 gene:ENSSHAG00000005818 transcript:ENSSHAT00000006744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSSTKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREETRKNMQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLTQSQRRLS
Download sequence
Identical sequences G3VU30
ENSSHAP00000006685 ENSSHAP00000006685 XP_003767540.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]