SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006695 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006695
Domain Number 1 Region: 33-87
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000112
Family CUE domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006695   Gene: ENSSHAG00000005826   Transcript: ENSSHAT00000006754
Sequence length 373
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856815.1:183986:205668:1 gene:ENSSHAG00000005826 transcript:ENSSHAT00000006754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLFRRSSSNGGSRGGGNASAQELNNSRPARQVRRLEFNQAMEDFKTMFPNMDYDIIEC
VLRANNGAVDATIDQLLQMNLDGSSYDDSSDSDDSIPPEILERTLEPDSSDEEPPPVYSP
PAYHMHMFDRPYPLAPPTPPPRIDVPSAGVPLTQRRYRNWNPPLLGNLPDDFLRILPQQL
DSLQNTQSGPPKLGLGEVSQPMVGNLEEECRWKQYLEDERIALFLQNEEFMKELQRNRDF
LLALERDRLKYESQKSKSSNMAVSNDFGFPSTVTGDAALGASEANPAVSEDALFRDKLKH
MGKSTRRKLFELARAFSEKTKMRKTKRKQLLKHQSYPWLLPGQEGCVCVCVCVCVCAHTH
THTLKIEDVNVSS
Download sequence
Identical sequences G3VU40
ENSSHAP00000006695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]