SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006821 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006821
Domain Number 1 Region: 1359-1427,1539-1615,1713-1738,1772-1826
Classification Level Classification E-value
Superfamily Sialidases 0.0000000746
Family Sialidases (neuraminidases) 0.044
Further Details:      
 
Domain Number 2 Region: 679-795,875-983,1026-1087,1244-1275
Classification Level Classification E-value
Superfamily Sialidases 0.00000706
Family Sialidases (neuraminidases) 0.022
Further Details:      
 
Domain Number 3 Region: 1482-1507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0001
Family Integrin beta EGF-like domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006821   Gene: ENSSHAG00000005926   Transcript: ENSSHAT00000006880
Sequence length 2460
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861637.1:191831:331598:-1 gene:ENSSHAG00000005926 transcript:ENSSHAT00000006880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSATRFRWSQSYYTTQDEWALDNIYIGQQCPNMCNGHGWCERGLCKCDQGYQGTECQPEA
SLPSTIMSDFESQNGWETDWQEVIGGEIVKAEQGCGVISSGSSLYFSKAGKRQLVSWDMD
TSWVDFVQFYIQIGGESTACNKPDSREEGVLLQYSNNGGIHWHLLAEMYFSDFSKPRFVY
LELPAAAKTPCTRFRWWQPVFSGEDYDQWAIDDIIILSEKQKQIIPVVNPTLPQNFYEKP
AFDYPMNQMSVWLMLANEGMVKNETFCSATPSAMIFGKSDGDRFAVTRDLTLKPGYVLQF
KLNIGCTNQFSSSAPVLLQYSHDAGLFWSLVKEGCYPASPGGKGCEGSSRELSEPTVYYT
GDFEEWTRITIVVPRSLASSKTRFRWIQESSSQKNAPPFGLDGVYISEPCPSYCSGHGDC
VSGVCFCDLGYTASHGTCVANVPNHSEMFDRFEGKLSPLWYKITGGQVGTGCGILSDGKS
LYFNGPGKREARTVPLDTTNIRLVQFYIQIGSKTPGATCSKPRARNEGLVVQYSNDNGIL
WHLLRELDFMSFLEPQIISIDLPREAKTSATAFRWWQPQHGKHSAQWALDDVLIGMNDSS
QTGFKDKFDGSIDLQANWYRIQGGQVDIDCLSMDTALTFSESIGKPRYAETWDFHVTAST
FIQFELSMGCSKPFSDSHGIQLQYSLNNGRDWHLVTEECVPPTIGCLHYTESSIYTSERF
QNWKRVTVYLPLSTISPRTRFRWIQSNYTPGADSWAIDNIVLASGCPWMCSGHGICELGH
CVCDRGFGGPYCVPIVSLPSVLKDDFNGNLHPDLWPEVYGAERGNLNGEIIKSGTSLIFK
GEGLRMLISRDLDCSKSLYVQFSLRFIAKGTPERSHSILLQYSISGGIIWHLMDEFYFTQ
TTNVLFINVPLPYTAQTNATRFRLWQPYNNGKKEEIWIVDDFIIDGNTINNPVILLDTFD
FGPKEDNWFFYPGGNIGLYCPYSSKGAPEEDSAMVFVSNEVGEHSITTRDLNVNENTIIQ
FEINIGCSTDSSSADPVRLEFSRDFGATWHLLLPLCYSSSSHISSLCSTEHHPSSTYYAG
TTQGWRREVIHFGKLHLCGSVRFRWYQGFYPASSQPVTWAIDNVYIGPQCEEMCNGHGSC
INGTKCICDPGYSGPTCKISTKNSDFLKDDFEGQLESDRFLLVSGGKPSRKCGILSSGNN
LFFNEDGLRMLMTRDLDLSQARFVQFFMRLGCGKGVPDPRSQPVLLQYSLNGGLSWSLMQ
EFLFSNSSNVGRYIALEIPLKARSSSTRLRWWQPSENGHFYSPWVIDQILIGGNISGNTV
LEDDFTTLDSRKWLLHPGGTKMPVCGSMGDALVFIEKASTRYVVTTDIAVNEDSFLQIDF
AASCSVTDSCYAIELEYSVDLGLSWHPVLRDCLPTNVECNRYHLQRILISDTFNKWTRIT
IPLPPYTRSQATRFRWHQPAPFDKQQTWAIDNVYIGDGCIDMCSGHGRCVQGNCVCDEQW
SGLYCDEPEIALPTQLKDNFNRAPSNQNWLTVNGGKLSTVCGAVASGMALHFSGGCSRIL
VTVDLNLTNAEFIQFYFMYGCLISPNNRNQGVLLEYSVNGGITWNLLMEIFYDQYSKPGF
VNLLLPPDAKETATRFRWWQPRHDGLDQNDWAIDNVLISGSADQRTVMLDTFSSAPVPQH
ERSPADAGPVGRIAFDIFMEDKTTVNEHWLFHDDCTVERFCDSPDGVMICGSHDGRETYA
VTHDLTPTEGWIMQFKISVGCKVSDRIAQNQVHVQYSTDFGVTWSYLVPQCLPADPKCSG
SISQPSVFFPTKGWKRITYLLPDSLVGNPVRFRFYQIYSDMQWAIDNFYLGPGCLDNCRG
HGDCLKEQCICDPGYSGSNCYLTHTLKTFLKERFDSEEIKPDLWMSLEGGSTCTECGILA
EDTALYFGGSTVRQAITQDLDLRGAKFLQYWGRIGSENNMTSCHRPTCRKEGVLLDYSID
GAGITWTLLHEMDYQKYISVRHDYILLPEHALTNTTRLRWWQPFVINNGIVVSGVERAQW
ALDNILIGGAEINPSQLVDTFDDEGISHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKD
KTHNILSSRELIIQPGYMIQFKIVVGCEASSCGDLHSVMLEYTKDTSRSDSWQLVQTQCL
PSSSNSIGCSPFQFHEATIYNSVNSSSWKRITIQLPDHVSSSATQFRWIQKGEEAEKQSW
GIDHVYIGEACPKLCSGHGYCTTGAVCICDESFQGDDCSVFSHDLPSYIKDNFESERVTE
VNWETIQGGVIGNGCGQLSPYAHGDSLYFNGCQIRQAVTKPLDLTRASKIMFVLQIGSTS
QTDSCNTNLSDPNTVDKAVLLQYSVNNGITWQVIAQHQPKDFIQAQRVSYNVPLEARMKG
VLLRWWQPRHNGTGHDQWALDHVEVVLVSTRKQNYMMNFSRQHGLRHFYNRRRRSLRRYP
Download sequence
Identical sequences G3VUG6
ENSSHAP00000006821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]