SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006865 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006865
Domain Number 1 Region: 91-159
Classification Level Classification E-value
Superfamily SET domain 0.0000366
Family Viral histone H3 Lysine 27 Methyltransferase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006865   Gene: ENSSHAG00000005963   Transcript: ENSSHAT00000006924
Sequence length 164
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849932.1:194365:195758:-1 gene:ENSSHAG00000005963 transcript:ENSSHAT00000006924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPEKVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQPHLRSALEAFRKQRD
LEAAYRALTLGGWMAHYFQSRGPQQEAALKTHIYRYLRAFLPESGFAILPCTRYSLETNG
AKVVSTRSWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMY
Download sequence
Identical sequences G3VUL0
ENSSHAP00000006865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]