SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007058 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007058
Domain Number 1 Region: 179-460,557-661
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.12e-72
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.001
Further Details:      
 
Domain Number 2 Region: 27-86
Classification Level Classification E-value
Superfamily UBA-like 5.91e-26
Family UBA domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007058   Gene: ENSSHAG00000006133   Transcript: ENSSHAT00000007120
Sequence length 1061
Comment pep:known_by_projection scaffold:DEVIL7.0:GL850041.1:207324:407197:-1 gene:ENSSHAG00000006133 transcript:ENSSHAT00000007120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFMKTGGGTFAQRRTEGKGWSKLQEAVHQQTFLNQLREITGINDTQILQQALKDSNGNL
ELAVAFLTAKNAKTPQQEETTYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIA
LSLEESNRAFRETGITDEEQAISRVLEASIAENKASLKRTHTEVWSDSPNPYDRKRQDNC
PVGLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYNPPASAQDLPRNQKEHRNLPFMRELRH
LFALLVGSKRKYVDPSRAVDILKDAFKSNGSQQQDVSEFTHKLLDWLEDAFQMKAEEERD
GEKPKNPMLELFYGRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIE
SLHSENSGKSGQEHWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMHK
NREITRIKRDEIKRLKEYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTS
PVDDIDASSPPSGSIPSQTLPSTAEQQQGTPSELPSTSPTPRSFIHKPFTQSRIPPDLPM
HPAPRHITEEELSVLEGCLHRWRTEVENDTRDLQESISRIHRTIEQMYSDKSMIQVPYRL
HAVLVHEGQANAGHYWAYIFDHHQERWMKYNDISVTKSTWEELERDSFGGYRNASAYCLM
YINDKEHFLIKEDFHKETGQKLVGMETLPTDLRDFVKEDNQRFEKELEEWDLQLAQKAQQ
EKILASQKMREPAPSVMTAQAEEPEYLEQPSRSDLAKYLKEETMQAITKASSEHEDKNPE
TVLQLAIKLEYARLVKLAQEDTPPETDYRLHHAVVYFIQNQSPKKIIERTLLEQFGNRNL
SFDERCRNIMKIAQAKLEMIKPEEVNMEEYEKWHQDYRSFRDTTMYLMIGLEHFQKKSYI
EAIQYLICAYQNNKELLSKGPYRGHDEELISHYRRECLLKLNEHAAELFESGEDQEVNNG
LFIMNEFIVPCLPLLLVDEMEEKDIVAVEDMRNRWCSYLGQEMEPNLQEKLTDFLPKLLD
CSTEIKGFNELPKLPSYSTHELCERFARIMLSLSRTPADGR
Download sequence
Identical sequences G3VV53
ENSSHAP00000007058 ENSSHAP00000007058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]