SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007079 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007079
Domain Number 1 Region: 132-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000768
Family EGF-type module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007079   Gene: ENSSHAG00000006150   Transcript: ENSSHAT00000007141
Sequence length 243
Comment pep:known_by_projection scaffold:DEVIL7.0:GL865048.1:208243:219871:-1 gene:ENSSHAG00000006150 transcript:ENSSHAT00000007141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAQPPPPQRTTSLLFLYLLVLSAVCHHVAASDAKDTSYPEKNDLFSGDHNPDGLELFTV
SEISSTSEISSGTEYDYYEEYEEEDPQLSGYVLDDSIRVGRLVKPKKNRTESEKNSSKTG
RKKFKNRKRKQKKINPCDGEYKNYCIHGECKYIESLEAVTCNCHQDFFGERCGEQSMKTH
SLGDGGSSITALAIVAAILSVLCFSAIVLITKQIWKAHYSIRDQETEERKHLKRENKNGI
ISV
Download sequence
Identical sequences G3VV74
XP_012408434.1.9362 ENSSHAP00000007079 ENSSHAP00000007079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]