SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007085 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007085
Domain Number 1 Region: 515-647
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-36
Family Phosphotyrosine-binding domain (PTB) 0.0000112
Further Details:      
 
Domain Number 2 Region: 247-288
Classification Level Classification E-value
Superfamily WW domain 0.000000000129
Family WW domain 0.0000897
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007085   Gene: ENSSHAG00000006156   Transcript: ENSSHAT00000007147
Sequence length 697
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849780.1:208821:227331:-1 gene:ENSSHAG00000006156 transcript:ENSSHAT00000007147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASLSPQPDVVNDNSRVGPVLSLALPLQAAHNQLLNAKLQSVAAAPKGLRSAMGEGGGA
ESGPANAKWVKEGQNQLRRAATAHQDQNRNMTLGGEPAPTVASSAKGLLHLYSELEISAR
NAANCGHLGSGLLIDLGPPEPQALPCSQEEEEGEEKAAGEEEDEEEEEEEEEEEDDLSSP
PGPCEPLEGSEGNSAQRTQPDGPRDHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGS
PEETDSFWNRNSFETDSDLPSGWMRVQDTSGTYYWHIPTGTTQWEPPGRAPPSQGSSPTE
ESQLTWTGFGHGETFEDGEFWKDVASEEPPMEPERKDSEDGALSFQALNIGTGLPQEQEK
LPLLNTNLGAKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKHNLHGPAQGGWG
EAAPLHPACGDSRLSIAFPRSKATVXIWALPGEPRGGPLWGEGLWGLGGGGVIFLGPRRA
GNKISLPQIMAERRSARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQKFQVYYLGNVPV
AKPVGVDVINGALESVLATSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLA
VGRDVHTFAFIMAAGPSTFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARPQASSSCL
PAPPADSVARRVGCTVRKGVQSLLGTLKPKRLGTHTP
Download sequence
Identical sequences G3VV80
ENSSHAP00000007085 ENSSHAP00000007085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]