SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007111 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007111
Domain Number 1 Region: 340-543
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.55e-57
Family Nucleotide and nucleoside kinases 0.0000169
Further Details:      
 
Domain Number 2 Region: 200-330
Classification Level Classification E-value
Superfamily SH3-domain 8.66e-36
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 134-218
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000342
Family PDZ domain 0.00072
Further Details:      
 
Domain Number 4 Region: 60-104
Classification Level Classification E-value
Superfamily L27 domain 0.000000883
Family L27 domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007111   Gene: ENSSHAG00000006179   Transcript: ENSSHAT00000007173
Sequence length 547
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861707.1:210626:236446:-1 gene:ENSSHAG00000006179 transcript:ENSSHAT00000007173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAAAAAMQQVLDNLTELPSSTGAGEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSD
NNLELVNEILEDISPLINVDENVAELVSILKEPHFQSFYKIHNSYRVFYVETLPPGFQVW
PRGYPSPLSDPPQVPHVQTSLKSSGSHKGVTFRVENNDLVIARILHGGMIDRQGLLHVGD
VIKEVNGHEVGNNPKELQELLRSISGSVTLKILPSYRDTVTPQQVFVKCHFDYDPYNDNL
IPCKEAGLKFSKGEILQIVNREDPNWWQANHVKEGGSAGLIPSQFLEEKRKAFVRRDWDN
PGPFCGTISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRS
LKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRAEMEADIKAGRYLEHGEYEGN
LYGTRIDSILEVAQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVD
AGITTKLLTDTNLKKTVDESARIHRAYNHYFDLIIVNDNLDKAFEKLQSAIERLRAEPQW
VPISWVY
Download sequence
Identical sequences G3VVA6
ENSSHAP00000007111 ENSSHAP00000007111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]