SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007195 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007195
Domain Number 1 Region: 227-393,689-907,953-991
Classification Level Classification E-value
Superfamily Ras GEF 9.55e-108
Family Ras GEF 0.00014
Further Details:      
 
Domain Number 2 Region: 374-464
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-19
Family PDZ domain 0.0042
Further Details:      
 
Domain Number 3 Region: 105-229
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.06e-17
Family cAMP-binding domain 0.0011
Further Details:      
 
Domain Number 4 Region: 599-678
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000174
Family Ras-binding domain, RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007195   Gene: ENSSHAG00000006253   Transcript: ENSSHAT00000007257
Sequence length 1492
Comment pep:novel scaffold:DEVIL7.0:GL834578.1:216186:344925:-1 gene:ENSSHAG00000006253 transcript:ENSSHAT00000007257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLNIIFFFFQLPADLNKLHLTENPHPQVTHVPSSQSGCSIASDSGSSSLSDIYQATESE
IGDVDLTGLPEAPVDSEDEEEEDEDIDRTADPLLGRDLVRECLEKEPADKTDDDIEQLLE
IMHQLPAFANMTMSVRRELCSVMIFEVVDQAGAVILADGQELDSWYVILNGTVEISYPDG
KSESLCMGNSFGIIPTLDKQYMNGVVRTKVDDCQFVCIAQEDYWRILNHVEKNTHKVEEE
GEIVMVQEHRELDRSGTRKGHIVIKATPERLIMHLIEEHSVVDPTYVEDFLLTYRTFLES
PLEVGNKLLEWFKLGSLRDKVTRVVLLWVNNHFNDFEGDPAMTGFLEEFEKNLEDTKMKG
HLRLLNIACAAKAKWRQIIFQKTSRESPLFFSLTGGSEGFGIFVEGVEPGSKAAEVGLKR
GDQIMEVNGQNFENITLGNALEILKNNTHLSLTIKTNIFVFKELINRTKQDKNGIPHIPK
IAEKKSNRYSIPDMPGDMEHMFPQEKGNKKIKANTVSVGRNKIRKILDKTRFSILPPKLF
SDGNVSQSQDDSVLGTRQCRHSLAIMPIPGTLSSSSPDLLQPTTSMLDFSNPTDIPDQVI
RVFKADQQSCYIIISKDTTAKEVVSHAVHEFSLMGAPETYSLCEVSVSSEGVIKQRRLPD
QFSKLADRIQLNGRYYLKNNMETETLCSDEDAQELLRESQITLLQLSTIEVATQLSMRDF
ELFRNIEPTEYIDDLFKLNSKTGNTHLKEFEAIINQETFWVATEILTESNQLKRMKMIKH
FIKIALHCRECKNFNSMFAVISGLNLAPVARLRGTWEKLPSKYEKHFQDLQDLFDPSRNM
AKYRNILSNQSMQPPIIPLFPIVKKDITFLHEGNDSKVDGLVNFEKLRMIAKEIRQVVRM
TSANMDPAVMFRQRSLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQ
YLANLNVETNEEKFQMMSLQWEPAYSTLTKNLNERRSTKSSEMSPVPMRSVGQITKAHLH
QPNRVSQVLQVPAVNLYPIRKKGPTKDHIAFGTSAPQKILGMSEEVSGKKLAEDTLSMAS
SLHSSPPASPQGSPRKVDNISSDHGSQLHLYGSSSCLTSETSTKTSGPRNYGIGYTHIPS
VKSENFSDSSHSEISSRSSIVSNCSVDSMSAALQEDRCLPQSFSSVDSVGAAEKKDHPSV
ATDHNQHVIGWTLSKPSVVKGLAVSSSLSTEEISHEHITIEAADSGRGSWTSCSSSSHDN
FQNIQNQKSWDLLNSYRHTHLDIPIAEVEPTNCEPYLYPEGYSQINSQPKDAAEWIQSRQ
SWASSSSLSDTYETNYGTVKRRVIEDSPAEPEEASDSHPSTDATYKTVTSSTEKGLIVYC
VTSPKKDDRYREPPPTPPGYMGISLADIKEGPPHHPHLKPPDYSVALQRSKMVHSNLSRL
SSACLVSEPMACISPKILFQPQRNSLQPSHPKLADVTDADSEADENEQVSAV
Download sequence
Identical sequences G3VVJ0
ENSSHAP00000007195 ENSSHAP00000007195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]