SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007222 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007222
Domain Number 1 Region: 910-1212
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.16e-90
Family Complement components 0.0000104
Further Details:      
 
Domain Number 2 Region: 1332-1464
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.57e-34
Family Alpha-macroglobulin receptor domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1490-1543
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000333
Family Ovomucoid domain III-like 0.014
Further Details:      
 
Domain Number 4 Region: 576-682
Classification Level Classification E-value
Superfamily E set domains 0.00000000168
Family SVA-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007222   Gene: ENSSHAG00000006276   Transcript: ENSSHAT00000007284
Sequence length 1549
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841440.1:217476:340250:-1 gene:ENSSHAG00000006276 transcript:ENSSHAT00000007284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPKFELLIEPPQYIRDLAACEKGTVHARYTFGKPVTGKLMINMTINGVGYYRHEVGHPV
LRTMEIHGSAVFDVCVKDMMPADVPEHFRGTVNIWATVTSVDGSQQVTFDDSTPVQKQLI
EIRYSKETRKQFKPGLPYRGKVEASYPDGSPANGVLIRIKAELTPKDNIYTSELLSQGGI
VDFEIPTIPPTAQYVWLETKVLAINGKPAGNQYLPNYLSISSWYSPSKCYLQLQAPESSF
QVGDEVRFPVKSTCPCDFTLYYEVASRGNIVQSGLQPANVTQQRSKRDAPPSDQTSHVTH
IPGTTSPETPGAEVEVCMTYLYLRVTPSMAPFSRLLVYYVRENGEGVTDSLQLAVQASFE
NQVSVTYSSNETRPGDIVDMKVRGAQGSCVCIGTVDKSIYLLKTGFQLTPAQVFQELTEY
DVSDTFGTPKEDGHFWWPGMSSHRRRRRSSVFPWHWDIAKDARFAFTETGLVVMTDSVSL
NHRQDGDMYTDEAVPAFQPHTGTLGSTAHSKIIPRAEKRKRTFFPETWMWHCLNISDPSG
EESLRVEVPDSITTWVTEAVGLSAVQGLGIAKPTELKTFKPFFIEFTLPYHVIRGEQTKI
PLSVYNYLAICVEVYVKISVPKGIKFVGHPGKHHLTRKKCVAPGEAKPTSIVLSFSELGL
SNITAKASAYGETNCCQGNFQIPKGSKHPEDNYFDKRTPVGTDYIRSSVIIEPEGLAREY
TYSVFFCPNEKIHISTPNKYEYQYVQKPLRMTHFDVAVKAHNDAHFALSSGSHDTAEMTE
IVIGGHQNSKTWISLSKMGDPVTSVDTIGILSWDEFRTFWISWKNGIIQVGHGIEPSNES
VIVEWGLSKSVEVKYIGFSTGWGSMGEYKIWRKEETDENHNEAFTLGVPLNVIPGSERAT
ASIIGDVMGPTLNHLDNLLRLPFGCGEQNMIHFAPNVFVLKYLQKTRQLSPEVESEATDY
LVQGYQRQLTYKRQDGSYSAFGERDASGSMWLTAFVLKSFAQSRGFIFIDPKELVSAKDW
IIRHQKEDGSFPAMGRILNKDIQGGIHGKISLTAYVVAALLETGITSEEEKTAISKAKHF
LESNLYSAEDPYSSALTAYCLTLLHSPAAPAVLRKLNSLAIMQDGFTHWSLTGTLVTDED
TFMGFNDGLSQSVISAEVEMTAYALLTYTLLGDVASALPVVKWLSQQRNALGGFSSTQDT
CVALQALAEYAILSYTGGVNLTISLASTNLDYQETFELNKSNQKVLQTAVIPSIPTGLFV
SAKGEGCCLMQIDVTYNVPDPVAKPAFQLFVNLKEPKTERHRFQSPLGLVSPAKKLETPQ
RDLPLVDDDDPASDQDHQEYKVILEICTRWLHSGSSNMAVLEVPLFSGFRADLESLEQLL
MNKQIGLKRYEVEGRKVLFYFDEIPSQCLTCVRFQAFREYIVGKTAPMPITVYDYYEPAF
EATRFYNVSESSPLARELCDGPTCNEVESSASQGPGKFGGLGKDTSCSTWGGPNYACLCS
RDCGYDGDPVCGSDGVIYQNHCQMEVAACRNSTRIEQVSAAHCTASKYL
Download sequence
Identical sequences G3VVL7
ENSSHAP00000007222 ENSSHAP00000007222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]