SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007229 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007229
Domain Number 1 Region: 657-787
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.72e-32
Family Synaptotagmin-like (S variant) 0.00000087
Further Details:      
 
Domain Number 2 Region: 487-611
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-21
Family PDZ domain 0.00000301
Further Details:      
 
Domain Number 3 Region: 3-95
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.32e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007229   Gene: ENSSHAG00000006282   Transcript: ENSSHAT00000007291
Sequence length 1076
Comment pep:novel scaffold:DEVIL7.0:GL841376.1:217856:588953:1 gene:ENSSHAG00000006282 transcript:ENSSHAT00000007291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLR
SNKVMWVCNLCRKQQEILTKSGAWFYNSGSNTPQHPDQQALRGMRNEEAPQEKKAKLHEQ
AQYQGTSGDLPAPSIDKSRPHGLMRQDSIKNGSGMKHPISSDTTSDRKRSPSISREQNRR
YDQQEEREEYTQYATSDSAMPRSPSDYDERRSHHGPQLFEEPEHIDYRDSNRRSRRRSQE
YIDDEDVENRDEYERQRREEEYQARYRSDPNLARYPVKPQPYEEQMRIHAEVSRARHERR
HSDVSLANTELEDSRIPMLRMERQSRQRSTSERRAVMENQRSYSMERTREAQGPSSNRQR
TTNHSPPTPRRSPIPIDRPDMRRTDSLRKPHHLDPSSAVRKTKREKMETMLRNDSLSSDQ
SESVRPPPPKPHKTKKGGKMRQVSLSSSEEELASTPEYTSCDDVEIESESVSEKGDMDYN
WLDHTSWHSSEASPMSLHPVTWQPSKDGDRLIGCILLNKRLKDGSVPRDSGAMLGLKVVG
GKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPE
PQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFL
SGQLSIKLWYDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVK
KTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEP
HWYKLQTHDVSSLPLPHPSPYLPRRQPHGESPTRRLQRSKRISDSEISDYDCDDGIGVVS
DYRHNGRDLQSSTLSVPEQVMSSNHCSQSGSPHRVDSIGRTRSWSPSVPPPQSRTVEQGL
RGTRPSSGHYNTISRMDRHRALDDHYSPERDRRNRQERRETNTYFDDIPHSPERNCEAAD
RQPYHRSRSTEQRPVLERTTSRSRSTERPDTNLMRSMPSLMTGRSAPPSPALSRSHPRTG
SVQTSPSSTPVAGRRGRQLPQLPPKGTLERNNGDKEIEPYEGLYIKEGLFYAESLF
Download sequence
Identical sequences G3VVM4
ENSSHAP00000007229 ENSSHAP00000007229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]