SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007255 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007255
Domain Number 1 Region: 171-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000318
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007255   Gene: ENSSHAG00000006305   Transcript: ENSSHAT00000007317
Sequence length 869
Comment pep:novel scaffold:DEVIL7.0:GL841414.1:219296:272918:-1 gene:ENSSHAG00000006305 transcript:ENSSHAT00000007317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKGLSKVLFLYCLMQGGWEGHLLYIVLPTNKGSNCLNPTACPNNSRCIETGKEYYCSCNP
GFTLASGDCIFTDPNEKCEDQDECADPTVCPQYSICISTPGNYIGSCKSSFVMRNRKNPV
MECQGRINLFPCHRILFGTQDGGHCECKPGFSQTIGEKHLLVRGVLGKSPDVDKCMDVTA
CPAHAMCTNAPGNYSCTCNLGSKSSTSEVSFRNQGTQCKRISPYMKVWSDCGPLSVGSHV
FQQRSLQSNQGRHYTKKDEKWGVGRSIPECKEDLDQEQVQDCHSNSTLPGLPEYTSFCTL
VDSIFNVLEDTCENKTTTVSLEKAAEKLTSVLEDASTWHNLNKKETSTLAIIFLDSVESA
TLEAFDSLSGNASQTVTNEYLETESKVIQDDCLAENLVLSAKGDSMKIECSTINEAISSG
ITGVAFTSLLGMESILDENFFYNPEANLTSSPQRLWMNSHIIGGIITGNKKDGFSNPIIY
TLENLQPKKRSDISICVSWDINVEGGRWTPKGCVTLHSTETHTQCSCNHLANMAVIMASG
EITMDFALFVISHVGMILSLVCLALAIATFLLCRSIQNHNTTLHLHLCICLFLAKLLFLT
GVAKTENKMVCAVIDGLLQYLFLACFAWMWVEAVMLFLMARNLKLVNFFGSQNIKVFYLC
AFGYGLPALIVEVATGSQWEGYGMHNHCWLHTDTGFIWSFVEPVCTVIMVCKSLVKIGKR
GRRKEFNPRPVLHFITTRLKFLIFLQINSVLLSWTLWILRKKLSSVNGEVLTFKYNRVLA
FKAFAQLFILGCSWILGISQIGPIARTMAYLFTIINSQSHSYHFLFLAFLNLQVREENKK
CFTGKTKSSTIPQTSGIWLSSMPTTSKMI
Download sequence
Identical sequences G3VVQ0
ENSSHAP00000007255 ENSSHAP00000007255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]