SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007256 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007256
Domain Number 1 Region: 78-199
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-23
Family PDZ domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 1-41
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000000122
Family PB1 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007256   Gene: ENSSHAG00000006306   Transcript: ENSSHAT00000007318
Sequence length 331
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841340.1:219445:331110:-1 gene:ENSSHAG00000006306 transcript:ENSSHAT00000007318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVMIGYADVHGDLLPINNDDNFFKAVSSANPLLRVFIQRQEEVDFCNFGTSTLTRKKKV
LKKKVLVTLRNDNLRRRPHLNISMPHDFRPVSSIIDVDILPETHRRVRLYRHGCEKPLGF
YIRDGTSVRVTSQGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQV
TDMMIANSHNLIITVKPANQRNNIIRSSRMSGSSGQSTDSTASHHSLPSSHAEQNFHPDE
MESDEETDIVIEGALEPQHISKTPSLPSSSLSRVNGTTFSHRLQRDLTLNNSSRESNGNL
HKLLSSLKSDPRHSLVIPRGGIEEDGTVITL
Download sequence
Identical sequences G3VVQ1
ENSSHAP00000007256 ENSSHAP00000007256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]