SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007321 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007321
Domain Number 1 Region: 332-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000222
Family Laminin-type module 0.04
Further Details:      
 
Domain Number 2 Region: 861-911
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000151
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 815-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000229
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 4 Region: 968-1020
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 5 Region: 921-970
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.05
Further Details:      
 
Domain Number 6 Region: 265-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000046
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 7 Region: 506-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 455-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 9 Region: 1078-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 10 Region: 767-817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family Laminin-type module 0.0039
Further Details:      
 
Domain Number 11 Region: 418-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000265
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 12 Region: 1020-1075
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Laminin-type module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007321   Gene: ENSSHAG00000006366   Transcript: ENSSHAT00000007383
Sequence length 1756
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861641.1:224502:363821:-1 gene:ENSSHAG00000006366 transcript:ENSSHAT00000007383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIVQISIPLYLSYLKLSKAQDECISGSCHPIVGDLLLGRSAQLTASSTCGLDGPQKYCII
GYLEGEQKCFICDSRYPYNPYTQANSHTIENVITTFESDRKKKWWQSENGLDNVSIRLDL
ETLFQFSHLIMTFKTFRPAAMLVERSVDYGQTWKIFRYFAKDCATSFPNIPSGQAQGVDD
LVCDSKYSDIEPSTEGEVVLKALDPSFEIENPYSPYIKDLVTLTNLRINFTKLHTLGDTL
LGRRPNDPLDKYYYALYDMVVRGRCFCNGHANKCGPTQDVRGDVFSPPGMVHGHCICQHN
TDGPNCERCKEFFHDVPWRPAEGLQDNACRSCNCNGHSERCHFDMSLYLSSNSVSGGVCE
DCQHNTMGQHCDQCKPLFYRDPFKEISDPHACIPCECDPEGSLSGGMCESYPDPVLGIEA
GQCFCKDNVEGPQCDQCKSGYYGLNANDPLGCQSCNCNPLGSVPFSTCDVVTGQCLCQQF
ATGPQCDECLVGYWGLKNNLHSCSPCDCDIGGAYSNLCSPNDGQCECRPHVIGHQCTEPE
PGYFFVPLDFYIYEAEDAMPISGSAPLVTSTFDHVVIKDPILGKPVTWTGLGFSQVLSGT
NLRFTINNIPYATNYAVAISYEPQSSADWTARMEILPSGPSRSEYCRHKAHLQEPQTLTL
PASDRIALFATPVCLEPGIQYSIDVHFSQPFIMNSQTHGHILIDSQKLGLIPQIDSVENF
CSKHLDEHQVNNCIEIASKPHHQILPDWCERLVVSISARIHNGAVACKCHPQGSIGSSCS
KVGGQCQCKPHVTGRCCDRCSTGAYGLGHHGCHPCECHPQGSKSTICDQITGQCSCHRDI
GGHRCDLCLPGYFGFPNCRPCPCNGFAELCDPETGSCFNCRGFTAGLHCERCIDGYYGNP
LSGKPCLPCQCPDVPSSNQYFAHSCYQNSWNLEVICNCQEGYTGIQCDECSSGFYGNPKI
SGDLCLPCVCNNNIDGADPASCSRVTGECLKCLYNTHGPNCQFCKPGYFGSALTQNCRKC
TCNPSGVNHTACAIGDTECLCDPTTGSCPCLPNVIGLTCDQCAEGYWNLVPRRGCQICEC
DPQHSHSTHCDQFTGQCPCKLGYGGKHCNKCEENYYGDPQVQCIECIRGRKGTQTAICDQ
ETGSCLCRAGVMGHFCDRCARGHFQEFPTCLRCPLCFDQWDNEISSLSEAVQGLIRLAAN
LEDKRETLPGCNADFKRLEDSMSEAERIWKHPVFSSGEFLNVKDYHDSVRTQVDQISQQV
NREYDFQDLNGTLVGIGKEVDDLLEDLQKKVHLASHVSNSSIRDTSMIEKYYQMSLSAEQ
KINDTIFIIKQSENTKNDLLTMIAGLTSKVNFSREKLKQIQTPDIQKLNEKVCGTPGNLS
CILSPCGGALCKDADEHRICGGPNCNGSLSLSRDAAKRAEETDSMINNLTNQLQLSENQI
RNITKLTQLTKTKALQLTEKLESMKDQIEPEEQRIKALIHKAKDFLLDENVPPEDIEKVA
NHVLDLNLPITSQNLTKELDKIDLLMKLCEDDQASGSSLKLKVTETQTLLEKSKDAEETV
NTLEEMLKNLKGAESIQRQTNSVVKQLTDEIQKMEMTILKAENFTNKTEGELEHISSQQS
TLEDEISNLQTKILRTRDQAFSVKAQAESAQDQANITEKDFIDLKKQFTILQNKTNAKGS
KKGTLSKVKQLKEEAEKLAGETEEKMQRIKDLEKKIQVLNQAKQEKVNQLKQLENHVLAI
KNEITTQENKYSTCHI
Download sequence
Identical sequences G3VVW6
ENSSHAP00000007321 ENSSHAP00000007321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]