SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007322 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007322
Domain Number 1 Region: 202-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000014
Family Laminin-type module 0.04
Further Details:      
 
Domain Number 2 Region: 771-821
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 725-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000215
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 4 Region: 878-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 5 Region: 988-1036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000204
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 6 Region: 135-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 7 Region: 831-880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.05
Further Details:      
 
Domain Number 8 Region: 376-417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 9 Region: 325-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 10 Region: 677-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.0039
Further Details:      
 
Domain Number 11 Region: 288-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 12 Region: 1036-1082
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000014
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 13 Region: 930-985
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007322   Gene: ENSSHAG00000006366   Transcript: ENSSHAT00000007384
Sequence length 1666
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861641.1:224502:361351:-1 gene:ENSSHAG00000006366 transcript:ENSSHAT00000007384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFKTFRPAAMLVERSVDYGQTWKIFRYFAKDCATSFPNIPSGQAQGVDDLVCDSKYSDI
EPSTEGEVVLKALDPSFEIENPYSPYIKDLVTLTNLRINFTKLHTLGDTLLGRRPNDPLD
KYYYALYDMVVRGRCFCNGHANKCGPTQDVRGDVFSPPGMVHGHCICQHNTDGPNCERCK
EFFHDVPWRPAEGLQDNACRSCNCNGHSERCHFDMSLYLSSNSVSGGVCEDCQHNTMGQH
CDQCKPLFYRDPFKEISDPHACIPCECDPEGSLSGGMCESYPDPVLGIEAGQCFCKDNVE
GPQCDQCKSGYYGLNANDPLGCQSCNCNPLGSVPFSTCDVVTGQCLCQQFATGPQCDECL
VGYWGLKNNLHSCSPCDCDIGGAYSNLCSPNDGQCECRPHVIGHQCTEPEPGYFFVPLDF
YIYEAEDAMPISGSAPLILATALPECEVYFHKQEGSFTIDSGNIVLERNKIQSSREQSEV
TSTFDHVVIKDPILGKPVTWTGLGFSQVLSGTNLRFTINNIPYATNYAVAISYEPQSSAD
WTARMEILPSGPSRSEYCRHKAHLQEPQTLTLPASGRIALFATPVCLEPGIQYSIDVHFS
QPFIMNSQTHGHILIDSLGLIPQIDSVENFCSKHLDEHQVNNCIEIASKPHHQILPDWCE
RLVVSISARIHNGAVACKCHPQGSIGSSCSKVGGQCQCKPHVTGRCCDRCSTGAYGLGHH
GCHPCECHPQGSKSTICDQITGQCSCHRDIGGHRCDLCLPGYFGFPNCRPCPCNGFAELC
DPETGSCFNCRGFTAGLHCERCIDGYYGNPLSGKPCLPCQCPDVPSSNQYFAHSCYQNSW
NLEVICNCQEGYTGIQCDECSSGFYGNPKISGDLCLPCVCNNNIDGADPASCSRVTGECL
KCLYNTHGPNCQFCKPGYFGSALTQNCRKCTCNPSGVNHTACAIGDTECLCDPTTGSCPC
LPNVIGLTCDQCAEGYWNLVPRRGCQICECDPQHSHSTHCDQFTGQCPCKLGYGGKHCNK
CEENYYGDPQVQCIECKCNKEGTQTAICDQETGSCLCRAGVMGHFCDRCARGHFQEFPTC
LRCPLCFDQWDNEISSLSEAVQGLIRLAANLEDKRETLPGCNADFKRLEDSMSEAERIWK
HPVFSSGEFLNVKDYHDSVRTQVDQISQQVNREYDFQDLNGTLVGIGKEVDDLLEDLQKK
VHLASHVSNSSIRDTSMIEKYYQMSLSAEQKINDTIFIIKQSENTKNDLLTMIAGLTSKV
NFSREKLKQIQTPDIQKLNEKVCGTPGNLSCILSPCGGALCKDADEHRICGGPNCNGSLS
LSRDAAKRAEETDSMINNLTNQLQLSENQIRNITKLTQLTKTKALQLTEKLESMKDQIEP
EEQRIKALIHKAKDFLLDENVPPEDIEKVANHVLDLNLPITSQNLTKELDKIDLLMKLCE
DDQASGSSLKLKVTETQTLLEKSKDAEETVNTLEEMLKNLKGAESIQRQTNSVVKQLTDE
IQKMEMTILKAENFTNKTEGELEHISSQQSTLEDEISNLQTKILRTRDQAFSVKAQAESA
QDQANITEKDFIDLKKQFTILQNKTNAKGSKKGTLSKVKQLKEEAEKLAGETEEKMQRIK
DLEKKIQVLNQAKQEKVNQLKQLENHVLAIKNEITTQENKYSTCHI
Download sequence
Identical sequences G3VVW7
ENSSHAP00000007322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]