SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007447 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007447
Domain Number 1 Region: 88-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000371
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 2 Region: 137-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000215
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 1-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000324
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007447   Gene: ENSSHAG00000006472   Transcript: ENSSHAT00000007509
Sequence length 781
Comment pep:novel scaffold:DEVIL7.0:GL841657.1:232897:264121:-1 gene:ENSSHAG00000006472 transcript:ENSSHAT00000007509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECQHSSSLCAPHGVCLNTPGSYTCTCRPGFAKHNGDHLMECVGNRMRATQLNTLNGY
VCLVNSHLLPEMRSSSGLVYLNSLPVQNVEDVDECQHNSSLCAPHGVCLNTPGSYMCTCK
PGFAKRNGNHFMECVGDKNECQDTSLCEPNGVCENTVGSYVCKCKPGFVQSLKNRADFGY
FCCLWEYKQDHIPCSSFIKYLKTLTQLKLCLYISWCSKLDNDTFSNLSSACRNGTAPLTL
EQFLEGFLITFDHDEKWANSNKEEIAQVVTFYLETVQKVAYEFALSLPSGNQSSVKKKLM
AITTLTIEGYCDKNNLTFKLKAGNEVMNLNCTLIAEKDSKGTGAVVFISYVSIGSIINET
FISKENLTIDEKLENIYLNSKVVSGTIGYSNDSFLSTPVIFTFQHIHMKSVKEKPLCVYW
DNTVWSNKGCKTISFNDSHTVCSCSHFSSFAVLMASVELKEDFVLTIITYVGLGLSLLCL
FLAALTFLLCRAIRGTGTLLHLQLSLCLFLANLLFLTGIERTEPKIMCSIIAGGLHYLYL
AAFTWMFLEGLHLFLTVRNLRVANYTSASRFKKRFMYPFGYGIPAVIVAVSAGIVPQGYG
TKHYCWLNLHMGFVWSFMGPVFFIILVSQKTTLIFCFCQNELKIKTVWFKHFLQFLQINL
SFYLTTLWILRDRLSALNKEVSTIQNNRTLTIKALAQLFILGCSWSLGFFLIDSIAEPIR
LIIAYAFTIINSLQGVYIFLVHCVFNRQVQEEYKKCFKRSKKRTETDTYVLSSSTSHTRT
V
Download sequence
Identical sequences G3VW92
ENSSHAP00000007447 ENSSHAP00000007447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]