SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007490 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007490
Domain Number 1 Region: 9-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.51e-69
Family G proteins 0.00000000155
Further Details:      
 
Domain Number 2 Region: 475-581
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-26
Family Pleckstrin-homology domain (PH domain) 0.00000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007490   Gene: ENSSHAG00000006509   Transcript: ENSSHAT00000007552
Sequence length 816
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841403.1:235293:280641:-1 gene:ENSSHAG00000006509 transcript:ENSSHAT00000007552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSVHFNFYRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVRQEIEAET
DRVTGTNKGISPIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPMDIEYQIRDMILQFIS
KESSLILAVTPANMDLANSDALKMAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLL
PLRRGYIGVVNRSQKDIDGKKDIRAALGAERKFFLSHPAYRHIADRMGTPHLQKTLNQQL
TNHIRESLPALRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIE
GSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTP
DLAFEAIVKKQLVKLKEPCLKCVDLVIQELINTVRQCTSKLGSYPRLREETERIVTTYIR
EREGRTKDQILLLIDIELSYINTNHEDFIGFANAQQRSTQLNKKRAVPNQGEILVIRRGW
LTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHV
FAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSM
DPQLERQVETIRNLVDSYVGIINKSIRDLMPKTIMHLMINNTKAFIHSELLAYLYSSADQ
NSLMEESADQAQRREDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSSSSRHS
PTPQHRPSASVPPPGRPPAVRGPTPGPPLIPVPVGVAASFVAPPIPSRPGPQNVFSNNDP
FSAPPQIPSRPARIPPGIPPGVPRRPPPSAPSRPFF
Download sequence
Identical sequences G3VWD5
ENSSHAP00000007490 ENSSHAP00000007490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]