SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007510 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007510
Domain Number 1 Region: 75-204
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.09e-45
Family Regulator of G-protein signaling, RGS 0.00000074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007510   Gene: ENSSHAG00000006527   Transcript: ENSSHAT00000007572
Sequence length 236
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856767.1:237160:255679:1 gene:ENSSHAG00000006527 transcript:ENSSHAT00000007572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKPLVFFSQLTMSDSKEKNFYKVIHAIGKEALNKDIKNRNKEKRNRLSLLLQKPEFHEN
VNLGGSSENLAKGTSVSPEEAVKWSESFDKLLSHKDGFDAFTRFLKTEFSEENIEFWAAC
EDFKKSQEPHQLFHKAQAIYEKFIQNDAPQEVNLDFHTKETIFKSISQPTIHSFDAAQSR
VYRLMEQDSYTRFLRSDIYLDLINGRPLRTTNLRRRSRSFTFNEFPAEKSDIAIWL
Download sequence
Identical sequences G3VWF5
ENSSHAP00000007510 ENSSHAP00000007510 XP_003767578.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]