SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007594 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007594
Domain Number 1 Region: 414-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-55
Family Eukaryotic proteases 0.00055
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-32
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 3 Region: 280-350
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 235-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000383
Family EGF-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007594   Gene: ENSSHAG00000006602   Transcript: ENSSHAT00000007657
Sequence length 720
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864890.1:243451:343994:-1 gene:ENSSHAG00000006602 transcript:ENSSHAT00000007657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELAFWTQAGLTLLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECVCPGKKE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWGGSLDDFYVKGFYCAECRGGW
YGGDCMRCGQVLRVPKGQILLESYPLNAHCEWTIHAKPGFIIQLRFVMLSLEFDYMCQYD
YVEVRDGDNSDSRIIKRFCGNERPAPIQSTGSSLHILFQSDGSKNFDGFHAIFEEITACS
SSPCFHDGTCLLDKAGAYRCACLAGYTGKHCESLLEEKNCSDPGGPVNGYRRTSDGSGLI
NGRYAKIGTVMSFFCNHSYVLSGNEQRTCQPDGEWSGKQPICIKACREPKISDLVRQRVL
PMQLQSRETPLHQLYSSTFSKQKLDSYPTKKPVLPFGELSPGYVHLHTQIQYECISPFYR
RLGSSRRTCLKTGKWSGRAPSCIPICGKIENVTAPKTPGTRWPWQAAIYRRTSSLQDGGL
HKGTWFLICSGALVNERTVVVAAHCVTDLGKSIVIKTAKLKVVLGKFYRDDDRDEKTLQS
LRISAIIVHPNYDPILLDSDIAVVKLLDKARISSRVQPICLAALRDFSTASEETQITITG
WKILADVRAPGFKNDSLRSGVVKVVDSLLCEQQYEDHGIQVSITDNMFCAQQDPTVPSNI
CPAETGGIAAVSLPGKASLEPSWHLMGLVSWGYDKTCSLKLYTAYTKVLPFKDWIEKNMK
Download sequence
Identical sequences G3VWN9
ENSSHAP00000007594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]