SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007689 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007689
Domain Number 1 Region: 573-678
Classification Level Classification E-value
Superfamily Bromodomain 2.22e-32
Family Bromodomain 0.00022
Further Details:      
 
Domain Number 2 Region: 1050-1169
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.62e-20
Family PWWP domain 0.018
Further Details:      
 
Domain Number 3 Region: 205-277
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.54e-17
Family PHD domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007689   Gene: ENSSHAG00000006679   Transcript: ENSSHAT00000007752
Sequence length 1185
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856880.1:249344:280651:1 gene:ENSSHAG00000006679 transcript:ENSSHAT00000007752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKPRRRSRQNAEGRRSPSPYSLKCSPTRETLTYAQAQRIVEVDIDGRLHRISIYDPLKI
ITEDELTAQDITECNSNKENSEQPLFPGKSKKPSSKGKKKESCSKHAPGTSFHLPQPSFR
VVESCSQPDAPPLPAAYYRYIEKPPEDLDADVEYDMDEEDLAWLDMVNEKRLVDGHGTIS
ADTFELLVDRLEKESYLESRSSGAQQTLIDEDAFCCVCMDDECHNSNVILFCDICNLAVH
QECYGVPYIPEGQWLCRCCLQSPSRPVDCVLCPNKGGAFKQTSDGHWAHVVCAIWIPEVC
FANTVFLEPIEGIDNIPPARWKLTCYICKQKGLGAAIQCHKVNCYTAFHVTCAQRAGLFM
KIEPMRETSLNGTTFTVRKTAYCEAHSPPGTVKKDVLPVISIEGEEEDEVKDGGGEEESK
VLVSSALKTTVKKNKMKVKQKIKKESEDSSKDSPATAPLVTITQIPSCRLNKICSGLSLQ
RKNQFMQRLHNYWLLKRQARNGVPLIRRLHSHLQSQRNAEQKEQDEKTSAVKEELKYWQK
LRHDLERARLLIELIRKREKLKREQVKVQQAAMELKLTPFNVLLRTTLNLLQEKDSAQIF
AEPVNLSEVPDYLEFISEPMDFSTMRLKLESHLYRTLEEFEEDFNLMVTNCMKYNAKDTI
FHRAAVRLRDLGGAVLRHARRQAENIGYDHEVGTHLPESPKMEDFYRFSWEDVDNILLPE
NRAHLSLEVQLKELLEKLDLVSTMRSSGARTRRVRLLRREINTLRQKLAQQQPNKMVPNG
ELPPGPREEVDVVEKALHGEEEEDGEKADDTKPPHPPTLEPTGPAPSLSDLDSLQDPPTL
KPISESKIPIRLSKYGKMEDEFLDMVPLQRGSQPFQHLLSDNGFNRLSLPVLEMSTMSSL
NGVGRRTSVLFKKAKNGVTFQRSPDGALENGEDHSLMDLPASPASTEDERQARKRPQSRS
CSESDGEKSPQQVEETGVTNGFGKHTESGSDSECSSGLGGGLAFETCSGLTPPKRSRGKP
ALSRVPFLEGVNGDSDYSSSGRSLLLPLEDNTDLEPLELVWAKCRGYPSYPALIIDPKMP
REGLLHNGVPIPVPPLDVLKLGEQKQVEAGEKLFLVLFFDNKRTWQWLPRDKVLPLGVED
TVDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRVRGHHPFVTSGYL
Download sequence
Identical sequences G3VWY4
XP_012404478.1.9362 ENSSHAP00000007689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]