SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007712 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007712
Domain Number 1 Region: 353-461
Classification Level Classification E-value
Superfamily PDZ domain-like 1.69e-25
Family PDZ domain 0.0000588
Further Details:      
 
Domain Number 2 Region: 220-328
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-25
Family PDZ domain 0.0032
Further Details:      
 
Domain Number 3 Region: 20-137
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000012
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007712   Gene: ENSSHAG00000006698   Transcript: ENSSHAT00000007775
Sequence length 651
Comment pep:novel scaffold:DEVIL7.0:GL861678.1:251208:567147:1 gene:ENSSHAG00000006698 transcript:ENSSHAT00000007775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDKWLERQEQDEDGTEEDNSRVEPVGHADTGLENATNLSLDDMVKLVEVNNNGGGPLGI
HVVPFSARGGRTLGLLVKRLEKGGKAEQENLFHENDCIVSINDGDLRNRRFEHPKPRAKD
MFRQAMCAPIIWFEVVPAAKKEQYEQLSQSEKNNYYPNRFNPDIQYMDNKSVNSAGLSAL
QRIPRLNNQADQTDSYSQLPHSANIAGKLPSTVSPSQQNVLSPTQSSGYSTKKIGKKLNI
QLKKGSEGLGFSITSRDVLVGGSAPIYVKNILPRGAAIQDGRLKAGDRLVEVNGLDLTGR
TQEAVVALLRSTKMGGTVSLLVFRQEEAFHPREMNAEPSQMQIAKETKPEDEDLVLTPDG
TREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQL
IAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKSNEAKSPGSPSGPELP
IETVLDDRERRISHSLYSGIESLDESPTRNAALSRIMGKYQLSPTVNMPQDDTVIIEDDR
LPVLPPHLSDQSSSSSHDDVGFAITDAGAWAKATISDSADCSLSPDVDPVLAFQREGFGR
QSMSEKRTKQFSDASQLDFVKTRKSKSMDLGIADETKLSTVDDQKTGKNGQ
Download sequence
Identical sequences G3VX07
ENSSHAP00000007712 ENSSHAP00000007712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]