SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007934 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007934
Domain Number 1 Region: 180-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000037
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 125-272
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000643
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007934   Gene: ENSSHAG00000006883   Transcript: ENSSHAT00000007997
Sequence length 546
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834443.1:266589:297589:1 gene:ENSSHAG00000006883 transcript:ENSSHAT00000007997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQVLLWAFCLFARFTPVLPMALDPCSAYISLNEPWRNTDHQLKEEEGQPTCDSNVDGEW
YRFTGMAGDAMPTFCIPENHCGTHAPIWLNGNHPQEADGIVQRQACASFNGNCCLWNNTV
EVKACPGGYYVYRLTKPSVCFHAYCGHFYDICDVVDCHGTCSNSECTCSEGTVLGPDQQT
CLDENECEKNNGGCSEICVNLKNSYRCECGVGRVLGSDGKTCEDIEGCQNKNGGCSHFCR
GYGNTYQCECPRGLVLSEDNHTCQVPMRCQSNAIEVNIPKDLVGGLEVFLTNTSCRGVSN
GTHINIYFSLKTCGTVVDVVNDKIIASNLVTGLPKQMPGSNGDIIIRTSKLLIPVICEFP
RLYTISEGYVPNLRNSPLEIMGRSQGIFPFTLEIFKDNEFEEPYRETLPTLKLRDLLYFG
IEPLVHVNGLETLVESCFATPTDKIDEILKHYLIRDGCVSDDSVKQYTSRDHLTKHFQVP
VFKFVGKDHQVVFLHCRVLVCGVLDEQSRCAQGCNRRMRREAIKEQGAHLQNHVLTSGPI
IIDRED
Download sequence
Identical sequences G3VXM9
ENSSHAP00000007934 ENSSHAP00000007934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]