SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008083 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008083
Domain Number 1 Region: 191-277
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-16
Family PDZ domain 0.018
Further Details:      
 
Domain Number 2 Region: 6-59
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000155
Family SAM (sterile alpha motif) domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008083   Gene: ENSSHAG00000007010   Transcript: ENSSHAT00000008149
Sequence length 537
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856966.1:277300:325420:-1 gene:ENSSHAG00000007010 transcript:ENSSHAT00000008149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLDDCLQQYVHKFEREKINGEQLLQISHQDLEELGVTRIGHQELVLEAVDLLCALNYGLE
TDNMKNLVLKLRASSNNLQNYISSRRKSSTYDGNSSRKPPNEFLTSVVELIGAAKALLAW
LDRTPFTGITDFSVTKNKIIQLCLDLTTSVQKDCPVAEMEDKVVNVSKVLNSICDKTIRS
TTDPVMSQCACLEEVHLPNVKPGEGLGMYIKSTYDGLHVITGTTENSPADKSQRIHAGDE
VIQVNKQTVVGWQLKNLVRKLRENPTGVVLLLKKRPTGSFNFTPAPLKNLRWKPPLVQTS
PPPTTTQSPESTMDTSLKKEKSAILDLYIPPPPAVPYSPRDEKGSFVYGGPSKCKQPLPG
SKGSESPNSFLDQESRRRRFTIADSDQLPGYSVEANVLPTKMREKTQSYGKPRPLSMPAD
GSWMGIVDPYARPRGHGRKGEDALCRYFSNERIPPIIEESSSRHRFSRPVNDRHLVRGAD
YIRGSRCYINSDLHNSATIPFQEEGSKKNSVSSSKKSSSTEPSLLVSWITRLKLLTH
Download sequence
Identical sequences G3VY28
ENSSHAP00000008083 ENSSHAP00000008083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]