SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008156 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008156
Domain Number 1 Region: 28-93
Classification Level Classification E-value
Superfamily UBA-like 0.00000112
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008156   Gene: ENSSHAG00000007068   Transcript: ENSSHAT00000008223
Sequence length 508
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861558.1:282198:376977:1 gene:ENSSHAG00000007068 transcript:ENSSHAT00000008223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKKQNQKDPSGFIFDLQSNTVLAQGGTFENMKEKINAVRAIVPNRSNNEIILVLQHFDN
CVDKTVQAFMEGNASEVLKEWTITGKKKNKKKKSKPKPTAEATNNLPDTNKLASTQDEQS
IASLDKGGINGYHVNGAANDTESVDSLSEGLEILSIDARELEDSESATSDMPDRTVSMLE
NGVSDFESKSLIMNATQTSQQSVKHESRNPTKSLSRPIPGTQFSGLGSLSTIEDVPLSST
NKKLGSNIEKSVKDLQRCTVSLARYRVVVKEEMDASIKKMKQAFAELQSCLMDREVALLA
EMDKVKAEAMEILLSRQKKAEMLKKMTDVAVRMSEEQLVELRADIKHFVSERKYDEDLGR
VARFTCDIDTLKMNIDSFGQVSHPKNSYSTRSRCSSVTSVSLSSPSDATVPSSSTCASAP
SLTNANKKNSPGGEIPAAIANPTSRSYQPHREVLQGNRRGGQSYRPQGQRSNGPTNQGRY
DNMGRYRNGSWYPSGSRREAVFFLVLSK
Download sequence
Identical sequences G3VYA1
ENSSHAP00000008156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]