SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008206 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008206
Domain Number 1 Region: 344-357,388-594
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 8.31e-36
Family Cofactor-dependent phosphoglycerate mutase 0.032
Further Details:      
 
Domain Number 2 Region: 215-279
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000561
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 3 Region: 13-45
Classification Level Classification E-value
Superfamily UBA-like 0.0000107
Family UBA domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008206   Gene: ENSSHAG00000007113   Transcript: ENSSHAT00000008273
Sequence length 608
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849656.1:286225:413761:-1 gene:ENSSHAG00000007113 transcript:ENSSHAT00000008273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESCLPSKGVNQQKALASTGGRSVQAACDWLFSHVGDPFLDDSLPREYVLYLRPTGPLAQ
KLSDFWQQSKQICGKNKAHNIFPHITLCQFFMCEDSKVDALGEALQATVMRWKCKFSAPL
PLELYTSSNFIGLFVKEDSAEILKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQAS
HLPTLEKLAQNIDVKLGCDWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIF
MSPMEQTSTSEGWIYGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILSTSSSSSSLM
FSDGILERRQQEEQGPGETSPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGK
YWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNT
IVDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGNTLPAWISPSDLA
AANLSVDTTYRPHIPVSKLVISESYDTYISRSYQVTKEIISECKSKGNNILIVAHASSLE
ACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGVWQLTDPPILPLTHGPTGGFN
WRETLLQE
Download sequence
Identical sequences G3VYF1
ENSSHAP00000008206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]