SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008291 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008291
Domain Number 1 Region: 220-327
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 4.59e-35
Family ProC C-terminal domain-like 0.0007
Further Details:      
 
Domain Number 2 Region: 63-219
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.5e-29
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008291   Gene: ENSSHAG00000007186   Transcript: ENSSHAT00000008359
Sequence length 328
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841408.1:293227:315813:1 gene:ENSSHAG00000007186 transcript:ENSSHAT00000008359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAAAAAAAAAAVAVATAASSTKVSASSTPLLNSPSTMSTNTITPPISISMGQLPWTAD
SPMQIGFVGAGRMAEAIAMGIIVSGKVEANNVMASAPSDKNLWHFQNLGCKTTHSNIEVL
QNCSIVFFATKPHILPMVLAEVSPVVTRKHVLVSVAAGVSLHTLEKLLPPKSRVLRIMPN
LPCRVQEGAVVMARGRHAEKCETDYLQKLLSVCGLCEEVPEAYINIHTGLSGSGVAYVCM
FSEALAEGAIKLGMPSGLAHQIAAQTLLGAAKLLLQSGQHPAQLRSEVCTPGGTTIYGLH
ALEQGGLRAAAMNAVEAATRRAQELNKQ
Download sequence
Identical sequences G3VYN6
XP_003760610.1.9362 ENSSHAP00000008291 ENSSHAP00000008291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]