SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008395 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008395
Domain Number 1 Region: 176-257
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.73e-25
Family PHD domain 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008395   Gene: ENSSHAG00000007276   Transcript: ENSSHAT00000008463
Sequence length 279
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849844.1:301242:312194:-1 gene:ENSSHAG00000007276 transcript:ENSSHAT00000008463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPANGEQIHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDEYYEKFKR
ETDSVQKRRVLHCIQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFETCQETN
DTMGNSGKTSQDKSKNETITPTEKPNNKRSRRQRNNENRENASNNHDHDDITSGTPKEKK
AKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSC
VGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR
Download sequence
Identical sequences G3VYZ0
XP_003765781.1.9362 ENSSHAP00000008395 ENSSHAP00000008395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]