SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008458 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008458
Domain Number 1 Region: 148-259
Classification Level Classification E-value
Superfamily C-type lectin-like 5.65e-41
Family Link domain 0.002
Further Details:      
 
Domain Number 2 Region: 3144-3301
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-41
Family C-type lectin domain 0.00000406
Further Details:      
 
Domain Number 3 Region: 253-363
Classification Level Classification E-value
Superfamily C-type lectin-like 1.64e-29
Family Link domain 0.0032
Further Details:      
 
Domain Number 4 Region: 3302-3361
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000445
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 29-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000161
Family V set domains (antibody variable domain-like) 0.016
Further Details:      
 
Domain Number 6 Region: 3098-3139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000661
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008458   Gene: ENSSHAG00000007330   Transcript: ENSSHAT00000008527
Sequence length 3404
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841287.1:306696:473003:-1 gene:ENSSHAG00000007330 transcript:ENSSHAT00000008527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSIKNILWIYSTLVVIHAVREVKMEKSPPVKGFLSGKVILPCHFSTMPTLPPSYNPTS
EFLRIKWSKIEEDKSGKDLKETTVIVAQNGNIKIGQGYKGRVSVPTHPEDVGDASLTMVK
LLASDAGLYRCDVMYGIEDTQDTVPLAVEGVVFHYRAATSRYTLNFEKAQQACLENGAVI
ANPEQLKAAYEDGFEQCDAGWLSDQTVRYPIRTPRAGCYGDMMGKEGVRTYGFRAPHETY
DVYCYVDHLEGDVFHVTGPNKLTFEEAKEECASQDARLATVGELHAAWRNGYDKCDYGWL
SDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPLPDSKFDAYCYKTKQNISESTTIP
LNIPVETASPNISKEPQIIPIQATSSIPLITELPVTQSNIPPIGEIVNIEQKVIFLPPGV
SEEKFEKVTIQPEASIGSSTAGSTERIWDVEYVPSASGPLEKPDTSESEEGVSLLPSSSL
ENGIFQQETATPPRATDFWERNTEDTHTQEVITQTEEIEVGPLVTHIETSEDSPVKESFT
LGTLDVSTEMGTKTEKEPTTISGLGPTDLYEFTLREDEEKHTIKPDQNIFAFSQIPEVIT
VSKISEKSNLTMTEHTDSLTTVTVTLPVSMPTKEGSFIDSVDETETSSKIIEDFSGQHGS
TLLPLENHTEVKIFASSQDLTSPQGLVEGTSTCIYPDQQTESLETEQTPKPEATTIHHTT
AETEKDMSKDPLYGRTEEEFSGMEPSLEKTDVTGYTDEMINYVDAFVTTTITTKISSEST
KAKDVEDEFLSTPVSLETDGPPDTTKMEENTTKVHSTSSTLNLEVITVSKWPLVEDNMTS
KPLASTEHVDTTDLPTALLTTAEASEKHFDAGRTFPLTTDITQRPGMEFTEESWKDKEEF
TVSSQSTPKTGIKEGPTVKYSPMDTIMEGSAIDEGLDLDTPQSVTTIYQFAQTVHREGTE
FNYSSSTQEPPVHVEAAQTVSLIPSVSSEGKVTQDVHLVDQTPFEATPSLEIIHTISTST
QITPVKFPVSEKEQPSEHPVFTTDFVATTSSEVLITPQAKDIDEHDLEGSAYPTSEDGLV
TDSKHVPVFKTTIGTTEHSISYPHYVSVTEHKVKTEVETVTLGITPEGLEQEAERRDSSP
IWESRSTLRPFTIEGILQGTEETVFEKKDETSQDYTEIGSGLLEEPKGTETVVPIAVATR
KTTVPHDMTTLFSSLDKIHSTSTSKSFVTKEKPLIIDREPGEETTSDMVIIGESTYHVTP
TPPDDMVTKELETDIDREYFTTSSASSIAQTTRQPTTEEGKDALGSQEVSTSEPQARETI
HPDINVYIITVTGNKTGRMSDMSIIGHPIDSNSKEDEPCSEETDDQTDFLTLLPDFIELE
PYFVDEEDDDCENSTEVTTTPSVQYINGKHLVTTIPKDPETAEARRGQFESVAPSPNFSH
GSETNPFELSEMESSTILQSRESKETLESFEITWKPDTYPETPEPFSGGESDVFPTDQQS
RATALHRTGSLEVVDPVTQNGPKLLNHSDENNETVLSFPEEASGEALVNQETQGAVLPKT
TEVAFKEVFGHDSMITSAPMTAPGSVSVDILPEERSFVHTGNHQATTISTVESWEDTTSR
NTTEFLGNPPLVLIPEGSGFLEEDRNQTSTVVASLLKHTLTVEMPSKGVPLNASKVTPTE
SNLGVSSSASYPVWEESSVEILATKFETQTKVPQSTSTSANSISISADEKNLGDERETTG
VLATSVKVSSTQPTMEQLIFTSEIKNSDEVQPTNPDSTTIENRSTEFDKNIVKSDHIPSE
PLFSNKSEEEYVNESSTIQHKVPESPTTVGVSSHSFLLEEGSGEVGSAMELTTESLASLK
VTNGDEVPTEYEVKEMTGTVPPHITYSMTFEPTEVLNSATDVSDIGIVNQLAGGNLSTEK
SQEVSDFLTDPPLKEVVTPESRNYSTVAHLLNVEETAAVEGSGGKTFMESGIIPFATTIS
ARSQSGTDSEGSGGTKVSLPAHLPGKFPLMTEGSGEEPTKISSSIDHISSSTTEKTFSTD
FPFAYSGSGDVDFITQTEVRHSPSPQLIPEHTEAAIGKVEEEVNSTDSMTHSLIVPPTNL
TVSTGHEVNIAGLGIESKASIEEKMAEQKPFESEKSTVATRVISDTEIFAESEPKTTDYS
ILTTKETLIGSKEPRPTDGDISFVSTIVPNLEEKALGIFVPLTEATKESPSSDDISVTES
QISESTGIEPAIGEEENTKRSILLAENDHIENNGPEDARPTVQDFHTEAVFSGEGSGGEV
FPSQSTDPFNFIRTEESTRMLTPDTHQPESSESSLEPGKTEEQEKKFSGTHEEIRYYGSQ
TNNVSEISHTIASTLLFESSGNNGDEEPILSPVTHSLKVEDFENQIFNEIEETQTSKQPS
ITEKLSQENSSQSESRGVTSSTLFFTKPSSLETTDVFVTSAPQISDQSYENSGEGSGWLG
GADSVHASTVAQRTVAITTVVPNSHEVKYSDFPSIEALATNESPTRVLPTQTEQNKNFQN
LPGTQPNLMAFESSTSHPLDDSKEFEVITLTPETRKFTENIILDLDKEDSDLILPTTKSS
TFEILPEITTDKNTIIDIDHTKTVYEDILTLQTETDPELQSGPYGNNEENIQLEEKEATA
FNLSFTEEKMEGSGDNLWPGPTQAISNESAASEDGIRLDQDYISRNSIHFTTGIPTPSMA
AESGVSLPTASSLAIPSMFSTISQDMKEQKIEAKYVATESTLDDLFESSTLSDGQPIADQ
SEEISTLSYLERTQSEDDGKKFMSSSFKPETSSGAEEVISDIVDVNIGHIKLIAQDLTGT
PEVIEGSNPTEYIETTSDAASAELYSQTPSIGATIHLVNSVSEFPKVIIPSSASDTDSDV
HQISLEQTFREVNSNAEATFKPPVEAKSQGIPFLASPGTHLAVEETETSATEVLIAKGET
MTPEYSQIYTDQIFSGETIKTPPGINLPKDETSLEAAVENNLEDALQGLLSIPTSPNYGV
VGDVLSQSGPQTTENPTTPFTSIEISTETQSIYNGVGSNQTPARTPDSDDQAMISTEELN
TEHITSSFLLLETSNGTDFLIGTNEDSVEGTAVYLSGRDLCKTNPCLNGGTCYTRDTTYV
CTCVPGYSGDQCEFDFDECQSNPCRNGATCVDGFNTFTCLCLPSYVGALCEQDTETCDYG
WHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQLFVNRVGHDYQWIGLNDKM
FEHDFRWTDGSTLQYENWRPNQPDSFFSSGEDCVVIIWHENGQWNDVPCNYHLTYTCKKG
TVACGQPPVVENAKTFGKMKPRYEINSMIRYHCKDGFIQRHLPTIRCLGNGRWALPKITC
QNPSSYQRTYSKKHLKNSSSAKDNSINSPKHYHRWSRRWQDSRR
Download sequence
Identical sequences G3VZ53
ENSSHAP00000008458 ENSSHAP00000008458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]