SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008459 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008459
Domain Number 1 Region: 1793-1950
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-41
Family C-type lectin domain 0.00000421
Further Details:      
 
Domain Number 2 Region: 1951-2010
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000025
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 1747-1788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000367
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008459   Gene: ENSSHAG00000007330   Transcript: ENSSHAT00000008528
Sequence length 2053
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841287.1:306696:376386:-1 gene:ENSSHAG00000007330 transcript:ENSSHAT00000008528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGRMSDMSIIGHPIDSNSKEDEPCSEETDDQTDFLTLLPDFIELEPYFVDEEDDDCENST
EVTTTPSVQYINGKHLVTTIPKDPETAEARRGQFESVAPSPNFSHGSETNPFELSEMESS
TILQSRESKETLESFEITWKPDTYPETPEPFSGGESDVFPTDQQSRATALHRTGSLEVVD
PVTQNGPKLLNHSDENNETVLSFPEEASGEALVNQETQGAVLPKTTEVAFKEVFGHDSMI
TSAPMTAPGSVSVDILPEERSFVHTGNHQATTISTVESWEDTTSRNTTEFLGNPPLVLIP
EGSGFLEEDRNQTSTVVASLLKHTLTVEMPSKGVPLNASKVTPTESNLGVSSSASYPVWE
ESSVEILATKFETQTKVPQSTSTSANSISISADEKNLGDERETTGVLATSVKVSSTQPTM
EQLIFTSEIKNSDEVQPTNPDSTTIENRSTEFDKNIVKSDHIPSEPLFSNKSEEEYVNES
STIQHKVPESPTTVGVSSHSFLLEEGSGEVGSAMELTTESLASLKVTNGDEVPTEYEVKE
MTGTVPPHITYSMTFEPTEVLNSATDVSDIGIVNQLAGGNLSTEKSQEVSDFLTDPPLKE
VVTPESRNYSTVAHLLNVEETAAVEGSGGKTFMESGIIPFATTISARSQSGTDSEGSGGT
KVSLPAHLPGKFPLMTEGSGEEPTKISSSIDHISSSTTEKTFSTDFPFAYSGSGDVDFIT
QTEVRHSPSPQLIPEHTEAAIGKVEEEVNSTDSMTHSLIVPPTNLTVSTGHEVNIAGLGI
ESKASIEEKMAEQKPFESEKSTVATRVISDTEIFAESEPKTTDYSILTTKETLIGSKEPR
PTDGDISFVSTIVPNLEEKALGIFVPLTEATKESPSSDDISVTESQISESTGIEPAIGEE
ENTKRKNNGPEDARPTVQDFHTEAVFSGEGSGGEVFPSQSTDPFNFIRTEESTRMLTPDT
HQPESSESSLEPGKTEEQEKKFSGTHEEIRYYGSQTNNVSEISHTIASTLLFESSGNNGD
EEPILSPVTHSLKVEDFENQIFNEIEETQTSKQPSITEKLSQENSSQSESRGVTSSTLFF
TKPSSLETTDVFVTSAPQISDQSYENSGEGSGWLGGADSVHASTVAQRTVAITTVVPNSH
EVKYSDFPSIEALATNESPTRVLPTQTEQNKNFQNLPGTQPNLMAFESSTSHPLDDSKEF
EVITLTPETRKFTENIILDLDKEDSDLILPTTKSSTFEILPEITTDKNTIIDIDHTKTVY
EDILTLQTETDPELQSGPYGNNEENIQLEEKEATAFNLSFTEEKMEGSGDNLWPGPTQAI
SNESAASEDGIRLDQDYISRNSIHFTTGIPTPSMAAESGVSLPTASSLAIPSMFSTISQD
MKEQKIEANTLDDLFESSTLSDGQPIADQSEEISTLSYLERTQSEDDGKKFMSSSFKPET
SSGAEEVISDIVDVNIGHIKLIAQDLTGTPEVIEGSNPTEYIETTSDAASAELYSQTPSI
GATIHLVNSVSEFPKVIIPSSASDTDSDVHQISLEQTFREVNSNAEATFKPPVEAKSQGI
PFLASPGTHLAVEETETSATEVLIAKGETMTPEYSQIYTDQIFSGETIKTPPGINLPKDE
TSLEAAVENNLEDALQGLLSIPTSPNYGVVGDVLSQSGPQTTENPTTPFTSIEISTETQS
IYNGVGSNQTPARTPDSDDQAMISTEELNTEHITSSFLLLETSNGTDFLIGTNEDSVEGT
AVYLSGRDLCKTNPCLNGGTCYTRDTTYVCTCVPGYSGDQCEFDFDECQSNPCRNGATCV
DGFNTFTCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAH
LTSILSHEEQLFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSSGE
DCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSMIRY
HCKDGFIQRHLPTIRCLGNGRWALPKITCQNPSSYQRTYSKKHLKNSSSAKDNSINSPKH
YHRWSRRWQDSRR
Download sequence
Identical sequences G3VZ54
ENSSHAP00000008459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]