SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008486 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008486
Domain Number 1 Region: 21-109,147-252,285-390
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.79e-28
Family LacY-like proton/sugar symporter 0.066
Further Details:      
 
Domain Number 2 Region: 420-477
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000291
Family Ovomucoid domain III-like 0.0082
Further Details:      
 
Domain Number 3 Region: 502-599
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000942
Family Glycerol-3-phosphate transporter 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008486   Gene: ENSSHAG00000007350   Transcript: ENSSHAT00000008555
Sequence length 651
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841148.1:309244:390227:-1 gene:ENSSHAG00000007350 transcript:ENSSHAT00000008555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGWGRFTPACLQRCNNPKGFLFHYCLLALIQGIVVNGLVNISISTIEKRYELKSSLTGLV
SSSYDISFCLLSLFVSFFGEKGHKPRWLAFASFMMGLGSLVYSLPHFTSGEYHIELKFAV
RNTCPAMGNTTSCRDASSKLSSYLYVFILGQLFLGVGGTPLYTLGTAFIDDSVATHKSSL
YIGIGFSMSVLGPAIGYVLGGQLLKIYIDVNMKKRQAKQLPLGTVVFFFLFFFFFFFFFF
FSLPLLKFSKSSIGIQKGTAETQAGKISQAHHNENATQTTDKNFGKSIKDFPTALKILLK
NPVFLCLALSTSTEALITTGFATFLPKFIENQFGLSSSFAATLGGVVLIPGAAVGQILGG
IIVSKFKMACKNIMKFSLLMAVMALILSFIFIFAKCGNEPFAGVSEAYNGYLLWTGMLGN
LTAPCNANCNCLNSFYYPVCGRDGIQYFSPCIAGCKNSVPESRPKSLGQKVYYNCSCIGR
TKQIPFAESTEAKAGKCEIGCTNMPIFLGFFFITVIFTFMASTPITVAILRCVNNHQRSL
ALGVQFVLVRLLGTIPGPIVFGFAIDSSCTLWDINQCGIRGACWIYDNIKMAFMLVGISV
GCKVLTIIFNGLAIFLYKPPPSGTNVTFESDNVVVASVPVESDHSKTRHDG
Download sequence
Identical sequences G3VZ81
ENSSHAP00000008486 ENSSHAP00000008486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]