SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008519 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008519
Domain Number 1 Region: 3005-3263
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-56
Family YWTD domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 1246-1511
Classification Level Classification E-value
Superfamily YWTD domain 1.07e-52
Family YWTD domain 0.00000189
Further Details:      
 
Domain Number 3 Region: 1869-2129
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-46
Family YWTD domain 0.0000118
Further Details:      
 
Domain Number 4 Region: 1582-1819
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-42
Family YWTD domain 0.0000299
Further Details:      
 
Domain Number 5 Region: 513-747
Classification Level Classification E-value
Superfamily YWTD domain 1.27e-39
Family YWTD domain 0.0000104
Further Details:      
 
Domain Number 6 Region: 178-446
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-38
Family YWTD domain 0.0000823
Further Details:      
 
Domain Number 7 Region: 2204-2448
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-34
Family YWTD domain 0.0000349
Further Details:      
 
Domain Number 8 Region: 2893-2997,3256-3317
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-22
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 9 Region: 1157-1238,1504-1557
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000272
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 10 Region: 825-867
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.0000883
Further Details:      
 
Domain Number 11 Region: 907-945
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 12 Region: 951-989
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 3464-3503
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 14 Region: 2670-2706
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 2537-2577
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 16 Region: 866-908
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 17 Region: 3344-3384
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 3-43
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 19 Region: 1035-1074
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000982
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 20 Region: 2709-2742
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 3424-3461
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 22 Region: 2791-2827
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 23 Region: 82-167,454-496
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000392
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 24 Region: 3387-3425
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 25 Region: 2577-2616
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000942
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 26 Region: 2829-2868
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000105
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 27 Region: 3308-3343
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 28 Region: 1822-1873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000782
Family EGF-type module 0.015
Further Details:      
 
Domain Number 29 Region: 2500-2538
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000798
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 30 Region: 2749-2783
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000942
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 31 Region: 1080-1117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 32 Region: 779-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000235
Family EGF-type module 0.041
Further Details:      
 
Domain Number 33 Region: 47-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000484
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 34 Region: 2634-2666
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000497
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 35 Region: 1822-1864,2135-2185,2449-2502
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000188
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 36 Region: 1120-1156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008519   Gene: ENSSHAG00000007379   Transcript: ENSSHAT00000008588
Sequence length 3514
Comment pep:novel scaffold:DEVIL7.0:GL861732.1:312077:396627:1 gene:ENSSHAG00000007379 transcript:ENSSHAT00000008588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKTCSPKQFACRDQITCISKGWRCDGEKDCPDGSDEAPEICPQSKVQRCQPNEHNCPGTE
LCVPMSRLCNGVQDCFDGTDEGAHCRELRANCSRAGCQHHCVPTLSGPSCYCNSSFQLQS
DNKSCKDFDECSVYGTCSQVCTNTDGAFTCSCVEGYLLQPDNRSCKAKNEPVDRPAVLLI
ANSQNILATYLSGVPVPTITPTGTRQTTAMDFSYANETVCWVHVGDNAAQTLLKCARMPG
LKGFVEEYSINISLSLHHVEQMAIDWLTGNFYFVDDIDDRIFVCNRNGDTCVTLLDVELY
NPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTKLVDSKIVFPHGITLDLVSRLVYW
ADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFENYLYATNSDNANSQQKTSVIRVN
RFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACENDQYGKPGGCSDICLLANSHKART
CRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRGMDMGAKVPDEHMIPIENLMNPRA
LDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDGIHNVEGVAVDWMGDNLYWTDDGP
KKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNGWMYWTDWEEDPKDSRRGRLERAW
MDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFYDRIETVLLNGTDRKIVYEGPELN
HAFGLCHHGSYLFWTEYRSGSVYRLERGPPGTTPTVTLLRSERPPIFEIRMYDAQQQQVG
TNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGVTCLANPSYVPPPQCQPGEFACAN
SRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFKCENNRCIPNRWLCDGDNDCGNS
EDESNSTCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLTQFT
CNNGRCINMNWRCDNEKDCGDGSDEKTCPEPAAQTQSPGREGRGQINQLRKEKIKKCGKQ
SSQEAVAVSSPATRPPGGCHTDEFQCRLDGLCIPLRWRCDGDTDCMDSSDEKNCEGITHV
CDPNVKFGCKDSGRCISKAWVCDGDSDCVDNSDEENCESLACKAPSHPCANNTSVCLTPD
KLCDGNDDCGDGSDEGDLCDQCSLNNGGCSHNCSVAPGEGILCSCPLGMELAPDNHTCQI
QSYCAKHLKCSQKCEQNKFSVKCSCYEGWMLEPDGESCQSLDPFKPFIIFSNRHEIRRID
LHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDKIYRGKLLDNGALTSFEVVIQYGL
ATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGDIEHPRAIALDPRDGILFW
TDWDASLPRIEAASMSGAGRRTIHRETGSGGWPNGLTVDYLEKRILWIDARSDAIYSARY
DGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRTNTQPF
DLQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYNRTVSCACPHLMKLDKDNTTCYVLDT
FFCLIRRIRRISVPLFPENKSTHVSFTVPDIDNVTVLDYDAREQRVYWSDVRTQAIKRAF
INGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTNKKQINVARLDGSFKNAVVQGLEQ
PHGLVVHPLHGKLYWTDGDNISMASLDGSNRSLLFSGQKGPVGLAIDFPENKLYWISSGN
HTINRCNLDGSGLEVIDTMRSQLGKATALAIMGDKLWWADQVSEKMGTCNKADGSGAVVL
RNSTTLVMHMKVYDESIQLGLQGTNPCSVNNGDCSQLCLPTSETTRSCMCTAGYSLRSGQ
QACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSGTSLAVGIDFHADNDTIYWVDMGL
STISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIYWTDQGFDVIEVARLNGSFRYVVI
SQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDGTERVVLVNVSISWPNGISVDYED
GKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFSVSVFEDFIYWSDRTHANGSIKRG
SKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCATSNGGCQQLCLYRGDGRRACACA
HGMLAEDGASCREYAGYLLYSERTILKSVHLSDERNLNAPVQPFEDPEHMKNVIALAFDY
RAAGSPGTANRIFFSDIHFGNIQQINDDGSGRVTIVENVGSVEGLAYHRGWDTLYWTSYT
TSTITRHTVDQNRAGAFERETVITMSGDDHPRAFVLDECQNLMFWTNWNEQHPSIMRAAL
SGANVLTLIERDIRTPNGLAIDHRAEKLYFSDATLDKIERCEYDGSHRYVILKSEPVHPF
GLAVYGEHIFWTDWVRRAVQRANKYVGSDMKMLRVDIPQQPMGIVAVANDTNSCELSPCR
INNGGCQDLCMLTPQGHVKCSCRGARILQDDFSCRAMNSTCRTQDEFECANGECISFSLT
CDGTSHCKDKSDEKPSYCNTRRCKKTFRQCNNGRCVPNTLWCNGADDCGDGSDEIPCNKT
ACAVDEFRCRDGSCISNSSRCNQFLDCEDASDEMNCSTTDCSSYFRLGVKGVTFLPCERT
SLCYASSWVCDGANDCGDYSDERDCPGVKPRCPLNYFPCPSGRCIPMSWTCDKEDDCEHG
EDEAHCNKFCSEAQFECQNHRCISKEWLCDGSDDCGDGSDEAAPCQGKTCGPSSFSCPGM
HFCVPDRWLCDGDKDCADGADESVAAGCLYNSTCDEREFMCQNRQCIPKHFVCDHDRDCA
DGSDESPECEYPTCGPSEFRCANGRCLSSRQWECDGENDCHDQSDEAPKNPHCTSPEHKC
NASSQFLCESGRCVSESLVCNGQNDCGDGSDERSCHINECLSRKLSGCSQDCEDLKIGYK
CRCRPGFRLKDDGRTCADVDECSTSFPCSQRCINTHGSYKCLCVEGYAPRGGDAHSCKAV
TDEEPFLIFANRYYLRKLNLDGTNYTLLKQGLNNAVALDFDYREQMIYWTDVTTQGSMIR
RMNINGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLNGAYRTVLVSSGL
REPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSGRSVVVDTKITWPNGLTLDYVTERIY
WADAREDYIEFASLDGSNRHIVLSQDIPHIFALTLFEDFVYWTDWETKSINRAHKTTGAN
KTLLISTLHRPMDLHVFHALRQPDVPNHPCKVNNGGCSNLCLLSPGGGHKCACPTNFYLG
GDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCGDHSDEPHDCPEFKCRPGQFQCSTG
ICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGED
ERDCPEVTCAPNQFQCAITKRCIPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDS
GRCIPARWKCDGEDDCGDGSDEPKEECDERTCEP
Download sequence
Identical sequences G3VZB4
ENSSHAP00000008519 ENSSHAP00000008519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]