SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008543 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008543
Domain Number 1 Region: 125-219
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 4.58e-36
Family VPS28 C-terminal domain-like 0.00027
Further Details:      
 
Domain Number 2 Region: 18-112
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 1.63e-34
Family VPS28 N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008543   Gene: ENSSHAG00000007400   Transcript: ENSSHAT00000008613
Sequence length 221
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841407.1:313556:321802:-1 gene:ENSSHAG00000007400 transcript:ENSSHAT00000008613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGMGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VTPNEYTAACSRLLVQYKAAFKQVQGSEINSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADIVSLFITVMDKLRLEIRAMDEIQPDLRELMETMNRMSHLPPDFEGRQKV
SQWLQTLSGMSAADELDDSQVRQMLFDLESAYNAFNRFLHA
Download sequence
Identical sequences G3VZD8
ENSSHAP00000008543 ENSSHAP00000008543 XP_003760589.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]