SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008763 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008763
Domain Number 1 Region: 263-415
Classification Level Classification E-value
Superfamily FAS1 domain 6.54e-28
Family FAS1 domain 0.0013
Further Details:      
 
Domain Number 2 Region: 431-571
Classification Level Classification E-value
Superfamily FAS1 domain 1.23e-24
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 3 Region: 72-199
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000314
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 197-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000167
Family EGF-type module 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008763   Gene: ENSSHAG00000007590   Transcript: ENSSHAT00000008836
Sequence length 732
Comment pep:novel scaffold:DEVIL7.0:GL861703.1:333129:375436:-1 gene:ENSSHAG00000007590 transcript:ENSSHAT00000008836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRSMHIGCQTKCVKTVITRECCAGFFGPQCQLCPGKVGNACFGNGICLDGVNGTGVCE
CEGRFSGTACETCMEGIYGSNCDQVCSCVHGRCSQGPNGDGSCECEVGWRGVKCDTEIKK
DDCNNTCHTSANCLLNSSGTAYCKCAAGFQGNGTVCTAIDACETSNGGCSTKADCRRTTP
GNRVCVCKAGYTGDGIVCLEINPCLENNGGCDRNAECTQIGPNQAACNCLQGYTGDGKTC
TLINICLTRNGGCNELAICNQTGVDERTCTCKPGYEGDGFTCRGPIYLELPKNTDTIPYF
FHLQENAIRDLMGPGPFTVFVPWKEALENASQTQVKEWITQGVMPQVLRYHVVACQKLLL
ENLKLIPSMTSLQGETIHINVSQDMVYVNGNAKIVSSDIICSNGVIHIIDQILVPKKLQE
IRKDASGNNAKDIISVAVQQGYLKFASMLQDTGLLSFINDPVHKPVTLFWPTDKALKDLP
QEQQDFLFGKDKDKLKQYLKFHIIRDSKILAVDLPSVASRKTLQGSELNVRCGDENNIGD
LFLNDQKCRIVQRQLEFDSGIAYGIDCMLINPSFGGRCDSFVTFNVSGECGSCYNIPRCP
TWSKPKGVKQKCFYHLPFRRNLEGCQQKCTMVMRLPKCCKGYFGRDCQACPGGSTTPCNN
RGVCIDEYFGDGECKCNTGFNGTACELCWPGRYGPDCKSCECSEHGTCDEGITGSGNCFC
ETGWTGRFCDTQ
Download sequence
Identical sequences G3W008
ENSSHAP00000008763 ENSSHAP00000008763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]