SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008815 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008815
Domain Number 1 Region: 1243-1404
Classification Level Classification E-value
Superfamily PH domain-like 6.88e-72
Family Pleckstrin-homology domain (PH domain) 0.0000000634
Further Details:      
 
Domain Number 2 Region: 1041-1242
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-51
Family DBL homology domain (DH-domain) 0.00000000609
Further Details:      
 
Domain Number 3 Region: 460-582
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-18
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 840-919
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000133
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008815   Gene: ENSSHAG00000007634   Transcript: ENSSHAT00000008888
Sequence length 1594
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849535.1:337439:447394:1 gene:ENSSHAG00000007634 transcript:ENSSHAT00000008888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTESQNVEHRFYGEKQGNLSRKHTSHSLRLSNKTRRMRHASSARVIHRNSEVSTRSSS
TPSIPQSLAENGMEPFSQEGKLEDFGSPIWVGRVGMGLRPVSCHTDSSITPSIDSSTILT
AASAQSMPDSEENRLYGNDSTYLPEGGRRQRPYTTNGTTFMETSSFKKKRSKSADIWRED
SLEFSLSDLSQEHLTSNEEILGSVEERDRGEDRGMEARDASQQLSTCHRANSLGVLYIPQ
NNGVKANHGPRSKFVGYCGNLMSDVPDLANRKMPSAVAEDTPPYSNYNTLPCRKSHCLSE
GATNSQISHSNSMQGRRAKTTQDVNIGEGSEFADSGIEGATIDTDLLSRRSNATNSSYSP
TTSRAFLGSDSGSSSTGDAARQGVYENFRRELEMSTNNSESLEEAGSAHSDEQSSGTLSS
LGQSDILLSAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYES
DGRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTISQTELENWI
TAIHSACATAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGDMQLSSVTDSKKKKT
ILDQIFVWEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSV
SSFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEG
DDTIKKSLEGIYDDTVPDGKREKEVVLSSVHQHNPDCDIWVHEYFTPSWFCLPNNQPALI
VVHPGDTARDILELICKVHQLGHAIHYLRLKFLIDNKMQYYVPKPEEDIYELLYQEIEIC
PKITRNIQIEKSDASNDNYGFSISSVEEEGVQRLYVNNVKETGLASKKGLKTGDEILEIN
NIAADTLNSSMLKDVLTQLSLCLIVQTYPELVGGQKLLESPPHRVDSLSDFSENPFAFLT
KNPGNSLCSEQVRSAEMTPEETDVRDLESSDESDKTNKKVVEVTQFCRSHILTEMNLSDL
SLLPQECTGPQLVTMRQLTDADKLRKVICELLETERTYVKDLNCLMESYLKPLQKETFLT
QDELDVLFGNLMEMVAFQVEFLKTLEDGVRLVPDLDKLERVDQFKKVLFSLGGSFLYYAD
RFKLYSAFCASHTKVPKVLVKARTDTAFKAFLDAQNPEQQHSSTLESYLIKPIQRILKYP
LLLKELFALTDEASEEHSYLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQMGEKK
EVADLSMGDLLLHTTVIWLNPPASLGKWKKEPELAAFVFKMAVVLVYKDGSKQKKKLVGS
HRLSIYEEWDPFRFRHMIPTEALQIRALTSADAEANSVCEIVHVKSESEGRPERSFHLCC
SSPESGKDFLKAVQSILRDKHRRQLLKTESLPSSQQYVPFGGKRLYTLKGARPAMSRAVS
APSKSLGRRRRRLARNRFTIDSDAVSTSSPKAESQHPSSGRDTDRWVEEQFDLAQYEEQD
DIKETDILSDDDEYCKSMKGSPVERDLQEQLQAASLSQQGRSPQAMDSHASRMTQLKKQA
ALSGINGGLENAGEEVIWVRREDFVPTRKLNTEI
Download sequence
Identical sequences G3W060
ENSSHAP00000008815 ENSSHAP00000008815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]